Details for Kale Locus Bo5g093140

Position : C5 ( 5`- 30209127 .. 30209730 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093140

Protein [Map View]
MAYEKVNELNLKDTELRLGLPGTGQVKEEQEVSCVRSNKRQHQSDNEEESTPPTKTQIVGWPPVRSYRKNNNSVVSYVKV
SKDGAPYLRKIDLKTYKNYSELLKELENMFKFTIGEYSEREGYRGSGVVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIM
KGSDALALDSAL*

DNA
ATGGCGTACGAGAAAGTCAACGAGCTTAACCTTAAGGACACAGAGCTTCGTCTTGGATTACCTGGAACAGGGCAAGTAAA
GGAAGAACAAGAAGTTTCTTGTGTTAGAAGCAACAAGCGTCAACACCAAAGCGATAACGAGGAAGAATCTACACCTCCTA
CGAAAACTCAAATCGTTGGTTGGCCTCCGGTGAGATCTTACCGCAAGAACAACAACAGTGTTGTGAGCTATGTGAAAGTG
AGTAAGGACGGAGCCCCTTACCTACGTAAAATCGATCTCAAAACATACAAAAACTATTCAGAGCTTCTCAAGGAGTTAGA
GAACATGTTCAAGTTCACAATAGGTGAATACAGCGAAAGAGAAGGATACAGAGGATCTGGAGTTGTACCAACGTACGAGG
ATAAAGATGGAGACTGGATGTTGGTTGGTGATGTTCCATGGGATATGTTCTCTTCTTCTTGTAAGAGACTCAGAATCATG
AAAGGATCCGATGCTCTTGCTTTAGACTCTGCCTTATGA