Details for Kale Locus Bo5g093110

Position : C5 ( 5`- 30162856 .. 30164826 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093110

Protein [Map View]
MIGQLINLKATELCLGLPGGAEANENLAKSAVGNKRGFSETVDLMLNLQSNKEGAVDLNNVASASKETTLLKDPAKPPAK
AQVVGWPPVRNYRKNIITQQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSS
FTMGNYGAQGMIDFMNESKLMDLLNSSDYVPSYEDKDSDWMLVGDVPWEMFVDSCKRLRIMKGAEAIGLAPRAMEKYCKN
RS*

DNA
ATGATCGGACAGCTTATTAACCTCAAGGCAACGGAGCTCTGTCTCGGCCTCCCCGGCGGCGCTGAGGCCAACGAGAATCT
GGCAAAATCGGCGGTGGGAAACAAGAGAGGCTTCTCAGAGACCGTTGATCTCATGCTCAATCTTCAATCCAACAAAGAAG
GAGCCGTCGATCTTAACAACGTCGCCTCAGCTTCCAAAGAGACAACTCTTCTCAAAGACCCTGCTAAGCCTCCTGCTAAA
GCCCAAGTTGTGGGATGGCCACCTGTGAGGAACTACAGGAAGAACATCATCACACAGCAGAAGACAAGCGGCAAGGAGGA
GGCCAGCAGCGAGAAGGCTGGAAATAGCGGCGGAGGAGCTTCCGGAGCTGCATTGGTGAAGGTATCCATGGACGGAGCTC
CCTACCTAAGGAAAGTGGACCTTAAGATGTACAAAAGCTATCAGGATCTCTCTGATGCTTTGGCTAAAATGTTCAGCTCC
TTTACTATGGGAAACTATGGAGCACAAGGAATGATAGATTTCATGAACGAGAGCAAGCTAATGGATCTGCTTAATAGTTC
TGATTACGTTCCAAGCTACGAGGACAAAGATAGCGATTGGATGCTCGTCGGGGATGTCCCATGGGAAATGTTTGTCGACT
CATGCAAACGTTTGCGCATTATGAAGGGAGCTGAAGCAATTGGACTTGCTCCGAGAGCAATGGAGAAGTACTGCAAGAAC
AGATCCTGA