Details for Kale Locus Bo5g093080

Position : C5 ( 5`- 30126056 .. 30127754 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093080

Protein [Map View]
MIGLLIGWSWRPRWTGLVYLGLRFLCTVPPGFGARRVWLAFTALSVCRTLWSRLGSSDKKSEESGETEAISRVSDTEDTE
KEQDLEHLLHLLEAENANMEWQSMMDKSTPNVSYQAWRHEPQSGPVVYRSRTVFEDATPETVRDFFWDDEFRPKWDPMLA
YFKTLEEDPNTGTTIVHWIKKSCCIYIIGRRIWESEKKYYAVTKGVPYPALPKRDKPRRVEIYFSSWIIKAVESRKGDGQ
LSACEVSLVHCEDMGIPKDVAKLGVRHGMWGAVKKLNSGLRSYQTARKAGAALSLSAQIARITTKLNMDVAETSRVDEEE
RGRDMEKARRRKDQFSVDWKLIVVGGVALACGLHSSAIGKALMFGAAQRLARR*

DNA
ATGATCGGGCTTTTGATTGGGTGGTCTTGGCGTCCGAGGTGGACCGGTTTGGTTTATCTAGGTCTCCGTTTTCTCTGCAC
TGTTCCGCCCGGTTTCGGAGCTCGCCGTGTTTGGCTTGCTTTCACCGCTCTCTCAGTGTGTCGCACTTTATGGTCAAGGC
TCGGTTCGAGTGACAAGAAATCGGAAGAGAGTGGTGAAACAGAAGCAATCTCAAGAGTTAGTGATACAGAAGATACAGAG
AAAGAGCAGGATCTAGAGCATTTGCTGCATCTGCTTGAAGCTGAAAATGCTAATATGGAATGGCAATCTATGATGGATAA
GTCTACTCCCAATGTGAGCTACCAGGCCTGGCGACATGAGCCTCAGTCAGGTCCTGTTGTGTATCGTAGTCGGACTGTTT
TTGAGGACGCAACTCCAGAAACTGTTAGGGATTTCTTCTGGGACGATGAGTTTCGACCTAAATGGGATCCTATGCTTGCT
TACTTCAAAACTTTGGAAGAAGATCCTAATACAGGAACAACTATTGTTCACTGGATTAAAAAGAGCTGTTGTATATACAT
CATTGGTAGGAGAATATGGGAATCTGAAAAGAAGTATTATGCTGTGACTAAGGGAGTACCGTATCCAGCTCTACCAAAGC
GTGATAAACCCAGGCGAGTTGAGATTTATTTCTCAAGCTGGATTATCAAAGCGGTTGAATCTCGAAAAGGAGATGGACAA
CTGTCAGCTTGTGAAGTCTCTCTTGTCCACTGCGAAGACATGGGAATCCCAAAAGACGTAGCAAAGTTAGGAGTCCGTCA
TGGCATGTGGGGAGCCGTCAAAAAGCTAAACTCCGGGTTAAGGTCTTACCAAACCGCTAGAAAAGCAGGGGCGGCTCTGT
CACTGAGCGCGCAAATTGCAAGAATCACTACAAAACTGAACATGGATGTGGCTGAAACATCGAGGGTAGATGAAGAAGAG
AGAGGGCGAGACATGGAGAAGGCAAGGAGACGAAAGGATCAGTTCAGTGTAGATTGGAAGTTGATCGTTGTAGGAGGAGT
TGCACTGGCGTGTGGGCTTCATTCAAGTGCTATTGGCAAGGCCTTAATGTTTGGAGCTGCGCAGAGACTTGCTCGTAGGT
GA