Details for Kale Locus Bo5g093070

Position : C5 ( 5`- 30122253 .. 30124419 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093070

Protein [Map View]
MDICMDKEPDGVVVYANNGDSCNPIQENVSVLPPLDIVPSDEDNGNTELLSTEESIEVKEYDVKECTNEIPVAKPLEDGN
MEIATLRKDAKSVNKSVLHAKHVSKPGRGSNKIRNTVPQPFALATAKRASSATRESHEVADMYSKIQKQVIKVPRKPLQP
KNKKLSDEEEDSCSVASYATSAAKSAKSRTIVTAAPSFRSTERAEKRKEFYTKLEEKHQAMEAEKTQSEARNKEEKDAAL
RQLRKSLMFKANPMPNFYHEGPPPKVELKKPPPTRAKSPKLGRRNTKEGNRSKGVSRRHETRKTLIVIAKEDNDDATTQK
SDQINQFAAEEVNQNLKPEPETAFAC*

DNA
ATGGATATCTGTATGGACAAGGAGCCAGATGGTGTGGTGGTCTATGCTAATAATGGTGATTCCTGTAACCCAATCCAAGA
AAATGTTTCTGTACTGCCTCCCTTAGATATAGTACCAAGCGATGAAGACAATGGAAATACAGAGCTTCTATCTACAGAAG
AGAGCATAGAAGTAAAAGAATACGATGTTAAGGAGTGTACTAATGAGATTCCAGTTGCTAAGCCATTGGAAGATGGCAAT
ATGGAGATAGCTACCTTGAGAAAAGACGCTAAGTCGGTAAACAAGTCTGTTTTGCATGCAAAACATGTTTCTAAACCAGG
TCGTGGGAGTAATAAAATAAGGAACACTGTTCCACAGCCATTTGCTTTAGCTACTGCAAAGCGTGCTTCATCTGCTACCC
GTGAGTCTCATGAAGTAGCAGATATGTACAGTAAAATACAAAAGCAGGTTATAAAGGTACCAAGGAAACCATTGCAGCCA
AAGAACAAGAAGCTCTCTGATGAGGAAGAAGATTCTTGCTCTGTTGCTTCTTATGCCACGTCAGCTGCAAAGTCTGCTAA
ATCAAGAACCATTGTCACTGCAGCTCCTTCGTTTCGATCCACCGAGCGTGCAGAGAAGAGGAAGGAGTTCTATACAAAAC
TAGAAGAGAAACACCAAGCCATGGAGGCAGAGAAAACGCAGAGCGAAGCAAGGAACAAGGAAGAGAAAGATGCAGCATTG
AGGCAATTAAGAAAGAGTTTGATGTTCAAAGCAAACCCAATGCCTAACTTCTACCATGAAGGGCCTCCTCCAAAGGTTGA
ACTTAAGAAGCCTCCTCCAACTCGAGCAAAGTCGCCAAAACTAGGGCGTAGAAACACAAAAGAAGGGAACAGATCCAAAG
GAGTTTCGAGGCGCCATGAAACTCGAAAGACTTTAATAGTGATCGCTAAAGAAGACAATGATGATGCAACCACACAGAAA
TCTGACCAGATAAACCAGTTTGCTGCTGAGGAAGTGAACCAAAATTTGAAACCGGAACCGGAGACTGCTTTTGCTTGCTA
A