Details for Kale Locus Bo5g045110

Position : C5 ( 5`- 15145498 .. 15146853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g045110

Protein [Map View]
MDENEIAAARREASSWNFPFNDINIQLHRRCNTSHEFDILKSPFGVNEEESNNHNPNYSNSESGKKETTDSGQSWSSSSS
KPSVLGRGHWRPAEDVKLKELVAIYGPQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRRAFTEEEEERLMQAHRLYVNK
WAMIARLFPGRTDNSVKNHWHVIMARKYREHSSAYRRRKLIINNPLKPHLPNHPSPNCPSFISTKHYFTRPFHEFNLTHH
LVNHASMTTDQNHLVLPFHCFQGYESTEAPMVVGMFGNQMMIEDNVGATSEALYNFPYVDSMSQGKGVPNEAMNLIGMEE
VDEEVAKKAKQQPHFFDFLGLGTA*

DNA
ATGGATGAGAATGAGATCGCCGCCGCGAGGAGAGAAGCTTCTTCTTGGAACTTCCCTTTTAACGATATTAACATTCAGCT
TCATCGTCGCTGCAACACAAGTCATGAATTTGATATCTTGAAGAGTCCTTTTGGAGTTAACGAAGAAGAGAGTAATAATC
ATAACCCTAACTATAGTAACAGCGAGAGCGGTAAGAAGGAGACGACAGATAGTGGGCAGTCTTGGTCTTCGTCGTCTTCA
AAACCGTCGGTCTTGGGTAGAGGACACTGGAGACCAGCTGAAGATGTTAAGCTCAAAGAGCTTGTCGCCATTTACGGTCC
ACAAAACTGGAATCTAATAGCTGAAAAGCTTCAAGGAAGATCCGGGAAGAGCTGTAGACTAAGGTGGTTTAACCAATTGG
ACCCGAGGATAAACCGAAGAGCTTTCACGGAGGAGGAAGAGGAGAGGCTAATGCAAGCACATAGGCTTTATGTTAACAAA
TGGGCAATGATTGCGAGGCTTTTTCCTGGTAGGACTGATAATTCCGTCAAGAACCATTGGCATGTTATCATGGCTCGTAA
GTATAGAGAACACTCCTCTGCTTACCGTAGGAGGAAGCTTATAATTAATAATCCACTTAAACCTCATCTTCCTAATCACC
CTAGCCCTAATTGCCCCTCTTTTATCTCCACTAAGCATTACTTTACTCGGCCTTTCCACGAGTTTAATTTGACTCACCAC
CTGGTTAATCATGCGTCTATGACGACTGACCAAAATCATCTTGTGTTGCCTTTCCATTGTTTTCAAGGTTACGAGAGCAC
TGAGGCTCCAATGGTCGTGGGTATGTTTGGCAATCAAATGATGATCGAGGATAATGTTGGTGCCACGTCAGAAGCGTTAT
ATAATTTTCCGTACGTTGACTCTATGAGCCAAGGGAAAGGAGTGCCAAATGAAGCAATGAATTTGATTGGAATGGAAGAG
GTAGATGAGGAAGTGGCAAAAAAGGCAAAGCAGCAACCACACTTTTTTGATTTTCTTGGCTTGGGGACGGCATGA