Details for Kale Locus Bo5g045070

Position : C5 ( 5`- 15119686 .. 15121005 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g045070

Protein [Map View]
MEANVIKLHGTPSIVTASSTARRHRSSILSIHYRNKRVSPFSLTVTRCSTTRSNETCQDSSLESSSLPSSKKGLVLDLGT
DSWDSEEIGSPVVKRFLSDNEERWYMWYHGRSTSSKQNLVSDSVGLAVSNNGIHWERGKGIVESTDDVGLVMTPCEDWWA
FDKANVRPREVVIMSSSKVRADSSVYWMYYTGYTTETVEFQSQGLNFELGNPERFEKASVFRSLPGLAISQDGRHWARIE
GEHHSGALFDVGSEKDWDFLYIASPHVVFHGSGDLRMYYHSFDAKTGEFCIGMARSREGIKWVKFGKILGGRKSEKEGLV
CFDEMGGRYPCVTRNKRDGSYVMAYEGVDRNGKMSIGLAVSIDGIKDWKRVQDEEAVLAVGEGGAWDSEGVGCPYLIEMD
GDSDHQWRLYYRGVGNGGRTGIGLAVSEGSEITKFTKQM*

DNA
ATGGAAGCTAATGTCATCAAACTCCATGGAACTCCTTCCATCGTCACCGCCTCTAGTACAGCTCGACGTCACAGATCATC
CATTCTCTCAATTCATTACCGGAACAAACGAGTTTCTCCGTTCTCGCTCACAGTCACAAGATGTTCCACCACCAGAAGTA
ACGAAACATGTCAAGATTCGAGCTTGGAGTCATCTTCTCTGCCGTCTTCGAAGAAAGGACTGGTTCTTGATTTAGGTACT
GATTCGTGGGACAGCGAGGAGATTGGATCTCCAGTCGTGAAGAGATTTCTAAGTGACAACGAAGAGAGATGGTACATGTG
GTACCATGGAAGAAGCACCTCCTCAAAGCAAAACCTAGTTTCAGATTCTGTCGGATTAGCGGTTTCAAACAATGGGATTC
ACTGGGAAAGAGGGAAAGGGATAGTTGAGTCGACGGACGATGTGGGTTTGGTCATGACCCCTTGTGAAGACTGGTGGGCT
TTCGACAAGGCTAATGTTCGGCCCCGTGAAGTAGTGATAATGTCTAGCTCCAAAGTCAGAGCTGATAGCTCTGTTTACTG
GATGTATTACACAGGCTACACGACCGAGACCGTTGAGTTTCAGTCCCAAGGTTTGAACTTTGAGTTGGGGAATCCAGAAA
GATTCGAGAAAGCTAGCGTTTTTAGGTCACTCCCCGGGTTAGCGATCAGTCAAGACGGTAGGCATTGGGCTAGAATCGAA
GGTGAGCATCATAGTGGTGCGTTGTTTGATGTTGGGTCTGAAAAAGATTGGGACTTTCTATACATTGCATCACCACATGT
AGTGTTCCATGGAAGTGGGGATCTAAGGATGTATTACCATTCTTTCGACGCGAAAACCGGTGAGTTTTGCATTGGGATGG
CGAGATCTAGGGAAGGGATCAAGTGGGTGAAGTTTGGTAAGATCTTAGGAGGAAGAAAATCTGAAAAGGAAGGTTTGGTT
TGCTTTGATGAGATGGGAGGAAGGTATCCTTGCGTGACAAGGAACAAGAGAGATGGGAGTTATGTGATGGCCTATGAAGG
TGTGGATAGAAATGGTAAGATGAGCATTGGCTTGGCGGTTTCGATAGATGGGATTAAGGATTGGAAACGGGTCCAGGACG
AGGAAGCAGTGCTTGCGGTTGGTGAAGGCGGTGCGTGGGATAGCGAAGGAGTTGGGTGTCCTTATTTGATTGAGATGGAT
GGAGACTCTGATCATCAGTGGAGGTTGTATTATAGAGGTGTTGGTAATGGTGGTAGAACAGGGATAGGTTTAGCTGTTTC
TGAGGGGAGTGAGATCACTAAGTTTACAAAACAGATGTGA