Details for Kale Locus Bo5g045060

Position : C5 ( 5`- 15117668 .. 15119293 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g045060

Protein [Map View]
MGGEQFEQKEGSPELLQSLRSKATELLFREEWEESIQLYTKFIDLSRTKITKLAGSDPDSIHKLKKSLCLALCNRAEARA
RLHDSSEAMRDCDQALEIENTHFKTLLCKGKVLLGLSKYSSALECFKTALLDPQASESVTEYMEKCKKLEFKAKTGAFDL
SDWILSGFRGITPELAEFIGSVEIKKSEGSGRGLFATKNIVVGTLILVTRAVATERGILGSEESGEKAQMIMWKNFVEEV
TKSVRRCDRTRRLVSSLSTGEEEEKLEIPDISLFRPEEASETYDDSKQDLGMEKLLSILDVNSLVEDAVSAKVIGKNKEY
YGVGLWTLASFINHSCVPNARRVHVGDYAVVHASRDIKAGEEITSAYFDVLSSPLEKRKEMAESWGFSCKCSRCKFESLL
SVANQEIREFEMGLERGVDAGNAVYTVEEGMKRWKVKGKDKGLLRASYWGVYEEVYNSERLMRRWGRKVPTMEVVVDSVC
DVIGSDERLLKMLVEGMKQKKNGGCSSSSIAEMEKVLKLGKGVYSKVVSKKKAMKTLVGLE*

DNA
ATGGGAGGAGAGCAATTTGAGCAAAAGGAAGGATCACCGGAGCTGTTGCAGAGCCTCAGATCCAAAGCGACGGAGCTTCT
TTTCCGGGAAGAATGGGAAGAGTCTATCCAGCTTTACACCAAGTTCATCGATCTCTCCAGGACCAAAATCACAAAGCTTG
CTGGATCCGACCCGGATTCGATCCATAAGCTCAAGAAATCCCTCTGCTTAGCTCTATGCAACCGAGCCGAAGCCAGAGCA
AGGCTTCACGACTCCTCCGAAGCGATGCGGGACTGTGATCAAGCACTCGAGATCGAAAACACCCATTTCAAGACTCTCCT
CTGTAAAGGTAAAGTCTTGCTCGGTTTGAGCAAATACTCATCGGCCTTGGAGTGTTTCAAAACGGCTCTGCTCGACCCTC
AGGCGAGCGAGAGTGTTACTGAGTACATGGAGAAGTGCAAGAAGCTCGAGTTTAAGGCAAAGACTGGAGCTTTCGATCTG
TCTGATTGGATCCTAAGTGGGTTTCGTGGGATAACTCCGGAGCTTGCTGAGTTCATTGGGTCGGTCGAGATTAAGAAGTC
TGAGGGTAGTGGGCGTGGGTTGTTTGCAACGAAGAACATCGTTGTAGGAACTTTGATCTTAGTCACAAGAGCAGTTGCTA
CTGAGAGAGGGATCTTAGGGAGTGAAGAGTCTGGTGAAAAAGCGCAGATGATTATGTGGAAGAACTTCGTGGAAGAAGTT
ACTAAATCTGTGAGGAGATGTGACAGAACACGGCGACTTGTCTCGAGTTTATCCACTGGAGAAGAGGAAGAGAAGCTGGA
GATTCCTGACATATCTCTCTTTAGGCCTGAAGAAGCATCTGAGACTTACGATGACTCGAAACAAGATTTGGGTATGGAGA
AGCTGCTAAGCATCTTGGATGTGAATTCTCTGGTGGAAGATGCGGTTTCAGCTAAAGTTATAGGGAAGAACAAAGAGTAT
TACGGTGTAGGGCTATGGACGCTAGCGTCATTCATCAACCACTCGTGTGTTCCAAACGCAAGACGGGTTCACGTTGGAGA
CTACGCGGTTGTTCATGCGTCAAGAGATATCAAGGCTGGGGAAGAGATCACTTCTGCTTACTTCGACGTGCTTTCTTCTC
CGCTGGAGAAGCGGAAAGAGATGGCTGAGTCATGGGGGTTTTCTTGTAAATGCAGTAGATGTAAGTTTGAGAGTTTATTG
TCTGTTGCCAACCAAGAGATTAGAGAGTTCGAGATGGGTTTAGAGAGAGGCGTAGACGCGGGAAACGCGGTTTATACGGT
GGAGGAAGGGATGAAGAGATGGAAGGTGAAAGGGAAGGATAAAGGATTGTTGAGAGCATCTTATTGGGGTGTTTATGAAG
AGGTTTATAACTCAGAGAGGCTTATGAGGAGATGGGGAAGGAAGGTTCCAACCATGGAAGTTGTGGTGGACAGTGTCTGT
GATGTCATTGGAAGTGATGAGAGGTTGTTGAAGATGTTGGTGGAAGGGATGAAGCAGAAGAAGAATGGAGGTTGTAGTAG
TAGTAGCATTGCAGAGATGGAGAAAGTCTTGAAGCTAGGAAAGGGTGTTTATAGCAAAGTTGTATCCAAAAAGAAGGCAA
TGAAGACTCTTGTTGGCCTAGAGTGA