Details for Kale Locus Bo5g045040

Position : C5 ( 5`- 15114933 .. 15116080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g045040

Protein [Map View]
MALRLASLKRAAVESCRIFETRSFSHVAAIPPPFNSVIDRPIVTPPLISPEFDENQSQSGLIDEKSFGFGFPSFAFSGSM
DLMAVPKKKVSKHKRGIRNGPKALKPIPVIIRCRSCGRVKLPHFFCCSGERVNPSEQGH*

DNA
ATGGCGTTGAGACTGGCATCGCTAAAACGCGCCGCGGTTGAGTCATGCCGCATCTTCGAAACCCGAAGCTTCAGCCACGT
CGCGGCTATTCCTCCGCCTTTTAACAGCGTCATCGATCGACCCATCGTTACGCCGCCGCTGATTTCACCTGAGTTCGATG
AGAATCAGAGTCAATCGGGTTTGATCGATGAGAAGAGCTTCGGATTCGGGTTTCCTAGTTTCGCTTTCAGTGGATCCATG
GACCTGATGGCTGTGCCCAAGAAGAAGGTTTCTAAACACAAGAGAGGGATAAGAAATGGGCCAAAGGCTCTTAAGCCTAT
TCCTGTCATCATCCGTTGCAGGAGTTGCGGGCGAGTCAAGCTGCCACATTTCTTCTGTTGCAGCGGTGAGCGGGTAAACC
CCAGTGAGCAAGGCCACTAG