Details for Kale Locus Bo5g045000

Position : C5 ( 5`- 15085644 .. 15086975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g045000

Protein [Map View]
MREENDYGAEPRERTLGLTPTWSVATVLTVFVVVSLIVERSIHRLSNWLRKTKRKPLFAALEKMKEELMLLGFISLLLTA
ISSTIANICVSSSFYDNRFVPCSRSEIIEEHDSTISSVKRTRLTRSPFFHILRRRLVGIGETTCSEGHEPFVSYEGMEQL
HRFIFIMAVTHVTYSCLTMLLAIVKIHRWRIWEDEAQMDRNDCLTGEHIVLSTPFRLAQKIPTLL*

DNA
ATGAGAGAAGAAAATGATTATGGAGCAGAACCAAGGGAGAGAACGTTGGGTCTAACACCAACTTGGTCCGTTGCTACAGT
TTTGACTGTCTTTGTAGTTGTTTCTTTGATTGTTGAGCGTTCCATTCATCGGCTTAGTAACTGGTTGCGGAAAACAAAGA
GGAAACCTTTGTTTGCTGCATTAGAGAAAATGAAAGAAGAGCTGATGCTGCTCGGATTCATATCTCTTCTTCTTACAGCT
ATCTCTAGCACAATAGCTAACATATGCGTTTCTTCAAGTTTCTACGACAACAGATTTGTCCCATGTTCCCGGTCTGAGAT
CATTGAGGAACATGATAGTACTATTTCATCTGTCAAACGGACTCGGTTGACGAGATCTCCTTTCTTCCACATCTTGAGGA
GAAGATTGGTTGGCATTGGCGAGACTACTTGCAGTGAGGGACATGAGCCATTTGTTTCATATGAAGGCATGGAACAATTG
CATCGCTTCATATTTATAATGGCAGTCACACATGTAACTTACAGCTGCTTGACTATGCTCCTTGCAATCGTGAAGATTCA
TAGATGGAGGATCTGGGAAGACGAGGCTCAGATGGATCGAAATGATTGCTTAACAGGTGAGCACATAGTGTTATCTACTC
CTTTCAGATTAGCACAAAAGATTCCTACTCTATTATAA