Details for Kale Locus Bo5g044990

Position : C5 ( 5`- 15071444 .. 15072327 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g044990

Protein [Map View]
MVLRSENLWTFLITVAIICRVSQSLHFELRSGRTKCISEDIKSNSMTVGKYTVVNPNEAHPSPPSHKISIRVTSSYGNTF
HHAEDVDSGQFAFTAVEAGDYMACFTANGHKPEVTLSIDFDWRTGIHSKSWGSVAKKSQVEVMEFEVKQLIETVNSIHDE
MFYLRDREEEMQNLNRGTNSKMAWLSFLSLFVCLGVAGMQFMHLKTFLEKKKVI*

DNA
ATGGTTCTCCGATCAGAAAACCTCTGGACGTTCCTGATAACCGTAGCGATTATCTGCCGCGTATCTCAATCTCTCCACTT
CGAATTGCGATCAGGTCGAACAAAATGTATATCGGAAGACATAAAAAGCAATTCAATGACCGTCGGTAAATACACCGTCG
TTAACCCCAACGAAGCTCACCCTTCTCCTCCCTCTCACAAGATCTCCATAAGGGTGACATCGAGTTACGGGAACACGTTT
CATCACGCGGAAGACGTGGACTCGGGACAATTCGCGTTCACGGCGGTTGAAGCTGGAGACTACATGGCTTGTTTCACTGC
CAACGGTCATAAGCCTGAGGTGACGTTGAGTATCGATTTTGATTGGAGGACGGGTATTCATTCCAAGAGCTGGGGTAGTG
TCGCCAAGAAGAGCCAAGTCGAAGTCATGGAGTTTGAGGTTAAGCAACTGATTGAAACCGTCAACTCGATTCATGATGAG
ATGTTTTATCTCAGAGACAGGGAGGAAGAGATGCAGAATCTGAACAGGGGTACAAACTCCAAAATGGCTTGGTTGAGTTT
CCTCTCTCTTTTCGTATGCTTAGGAGTCGCCGGAATGCAGTTTATGCACTTGAAGACGTTTTTGGAGAAGAAGAAAGTCA
TCTAA