Details for Kale Locus Bo4g190580

Position : C4 ( 5`- 51303903 .. 51305956 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190580

Protein [Map View]
MGLRMSESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVRSKMTFSIFMHIFVL
ALLGPVINQNLYYIGLKLTSPTFSTAVSNIAPAITFILATLFRMERVEMRKVRCQVKVVGTLVTVVGSILMILYKGPFIS
SFRSQLTTASSPLAGDYLKATIFLLIASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSALNIG
FDMNLLASVYAGIMSSSIAYYIQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQGTYLGGGIGVVVLTVGVYTVLWAK
HLDDDGEAICREDNPTLEAVKCCSGNNGLSIMPKIDEAHEDVETGKIKSEEKESSAVVVGFGCGFWF*

DNA
ATGGGACTAAGGATGTCAGAATCAGCTAAACCATACTTTGCAATGATTTGCCTTCAGTTTGGATACGCCGGTATGAACCT
GGTCACTAAAACCGTCCTTGACCGTGGTATGAGCCATTACGTTCTTGTTGCATACCGCAACGCTTTTGCCACAGCCGCGA
TCGCACCTTTCGCATTTCTCTCCGAAAGGAAAGTGAGGTCAAAGATGACGTTTTCAATATTCATGCACATATTTGTTCTT
GCTCTTCTTGGGCCTGTGATTAATCAGAACCTATACTACATCGGTCTGAAACTCACATCTCCGACGTTTTCCACGGCCGT
CAGCAACATCGCGCCCGCTATTACCTTTATCCTCGCCACTCTTTTCAGGATGGAGAGAGTGGAGATGAGAAAAGTAAGAT
GCCAAGTAAAAGTGGTGGGGACATTAGTGACAGTGGTTGGATCAATACTGATGATATTATACAAAGGCCCGTTCATCAGC
TCCTTCCGATCTCAACTCACCACCGCCTCTTCGCCGCTGGCCGGTGATTATCTTAAAGCCACCATCTTCCTCCTCATCGC
CTCCCTCTCATGGGCGTCGTTCTTCATTCTTCAGGCATCGACTTTGAAGAAATACTCAGCCCATCTCTCGTTATCAACGA
TGGTCTGTTTCATGGGAACGTTGCAGTCCTTAGCCCTAACCTTCGTAATGGAACATAATCCTTCGGCTTTGAACATCGGT
TTTGACATGAATCTTCTCGCGTCTGTATACGCGGGAATAATGTCGTCGAGCATAGCTTACTACATTCAAGGACTTATGAT
GCAGCGAAAGGGGCCTGTCTTCGTCACTGCTTTTAACCCTCTTGTCGTTGTCATTGTCTCCATAATGAGCTTCTTTGTTC
TCGGCCAAGGAACCTATCTTGGAGGGGGTATTGGAGTGGTAGTTTTGACGGTGGGAGTCTACACCGTGTTATGGGCAAAG
CACCTAGACGATGACGGTGAAGCAATATGCCGTGAAGATAACCCAACTTTAGAAGCCGTTAAGTGTTGTAGTGGCAATAA
TGGTCTCTCCATAATGCCGAAAATAGACGAAGCTCATGAGGATGTTGAAACCGGGAAAATCAAGTCGGAAGAGAAGGAAT
CATCGGCAGTGGTTGTGGGTTTTGGTTGTGGTTTTTGGTTTTGA