Details for Kale Locus Bo4g190520

Position : C4 ( 5`- 51286321 .. 51287808 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190520

Protein [Map View]
MNCLATTITITFKPTLISDMAVAIDPFSDKFPYFNRSSQRCRLQSLTNLDFSFLQSFKPKPEDDNIHRSVSSPCFSIASS
ANMEEDKKATAAPRIEILGGQRVPTVRALVAEVTMAIVSGAQPMLLPSGLGGAYLLQTGKGHNIAVAKPVDEEPLALNNP
KKSGSLRLGQPGMKHSIPVGETGVRELAAYLLDYQGFSSVPPTALVSISHVPFHVSAAFSSVPYKVASLQKFVCHDFDAG
ELGPGSFTVASVHRIGILDVRVLNLDRHAGNMLVKRCEQDEGVGTAELVPIDHGLCLPECLDDPYFEWLNWPQALVPFTE
TELEYISNLDPFKDAELLRNELHSLPESAIRVLIVCTVFLKQAAASGLCLAEIGEKMTRDFARSEDSFSLLETLCTKAKT
TVVDKGNEVKCEVEISEIIHVSKPPLAPKGPHAKEKKRGNTMRSKSPSMSVQYVESEGVSFGDMTTVQWDMFLESFQRLL
QEALSKRLVPSLGKQ*

DNA
ATGAATTGCTTGGCTACGACCATAACCATCACTTTCAAACCAACATTGATCTCGGATATGGCCGTGGCTATTGATCCATT
CAGTGACAAGTTCCCTTACTTCAACCGTTCCTCACAAAGATGCAGACTCCAATCCCTCACCAACCTTGACTTCAGCTTCC
TTCAATCCTTTAAACCAAAACCTGAAGATGACAACATCCATAGAAGTGTATCTTCTCCTTGCTTCTCTATAGCTTCCTCT
GCTAACATGGAGGAAGATAAGAAAGCAACCGCTGCTCCACGGATTGAGATTCTTGGTGGACAGAGAGTTCCCACCGTTCG
TGCCCTAGTGGCTGAGGTGACCATGGCTATTGTCTCCGGAGCCCAGCCTATGCTTTTACCAAGTGGCTTGGGAGGTGCCT
ATCTTCTCCAAACCGGGAAGGGTCACAACATTGCTGTGGCTAAACCGGTTGATGAGGAGCCTTTAGCTTTAAACAACCCT
AAAAAGTCTGGAAGTTTGAGGCTAGGGCAACCTGGAATGAAACATTCTATTCCTGTTGGTGAAACTGGTGTAAGAGAGTT
AGCTGCTTACTTACTTGACTACCAAGGCTTCTCTAGTGTTCCACCAACAGCTTTGGTTAGTATCTCACATGTTCCTTTCC
ACGTCAGCGCCGCCTTCTCCTCTGTGCCCTATAAGGTTGCTTCCTTGCAGAAGTTTGTGTGTCATGATTTTGATGCTGGA
GAGTTAGGTCCAGGAAGCTTCACGGTTGCTTCGGTTCATAGGATAGGTATACTTGATGTGAGAGTCTTGAACCTTGACAG
GCACGCAGGGAATATGCTAGTGAAGAGATGTGAACAAGACGAGGGAGTTGGAACTGCTGAGCTTGTCCCTATAGATCATG
GTCTATGCCTCCCTGAGTGTCTAGATGATCCTTACTTTGAGTGGCTTAACTGGCCTCAAGCTTTGGTTCCATTCACTGAA
ACTGAGCTGGAGTATATATCTAATCTAGATCCTTTCAAAGACGCGGAGCTTCTTAGAAATGAACTGCACTCTTTGCCTGA
ATCTGCCATAAGGGTCCTTATAGTATGCACCGTTTTCTTGAAACAAGCAGCTGCTTCAGGGCTTTGTCTTGCAGAGATAG
GTGAGAAGATGACTCGGGACTTCGCTAGAAGTGAAGATAGTTTCAGTCTCTTGGAGACCCTTTGCACCAAAGCAAAAACA
ACTGTAGTTGACAAAGGAAATGAAGTGAAATGTGAAGTGGAGATCTCAGAGATCATTCATGTATCTAAACCACCTTTGGC
TCCCAAAGGACCACATGCAAAAGAAAAGAAGAGAGGAAACACCATGAGGAGCAAGAGCCCATCAATGAGTGTGCAATATG
TTGAATCAGAAGGTGTTTCTTTCGGGGACATGACAACAGTCCAATGGGACATGTTCCTGGAGAGCTTCCAGAGACTTTTG
CAAGAAGCACTGAGCAAAAGGCTAGTGCCAAGTTTAGGAAAACAATAA