Details for Kale Locus Bo4g190500

Position : C4 ( 5`- 51278897 .. 51280702 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190500

Protein [Map View]
MSSTASSPQRVLQPGGYNGNDSRTSSTSSSFLRPELESSETEEAELVSVSWNQDSSCFAAGTSHGFRIYNCEPFKETFRR
DLKNGGFRIVEMLFRSNILALVGGGPNSQYPSTKVLIWDDHQSRCISEFSFRSEIRAVKLSRDWIVVVLEHKIYVYSFVD
LRLLLQIETHANPRGLCCLSHDSDTSVLACPGLLRGEIRVEHFGLNMVQTVNAHDASIACMTLTLDGLLLATASTKGTLI
RIFNTMDGTRLQEVRRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVVGEDSDSTESAALLTQQTYSNSLQGLV
SPATGTNPGSSLSFMRGVLPKYFSSEWSFAQFHVSEVTQFFAAFGSHNTVAITGMDGSFYRCSFDPVNAGEMVQLEHIHF
LKTDNRPR*

DNA
ATGAGTTCAACCGCTTCGAGTCCCCAAAGAGTCCTGCAACCAGGTGGTTATAATGGTAATGACTCTCGAACCAGCAGCAC
TTCTAGTTCTTTTCTGCGTCCAGAGTTAGAATCCAGCGAAACCGAAGAAGCAGAGCTAGTTTCTGTCTCCTGGAACCAGG
ACTCCAGTTGTTTCGCTGCTGGAACAAGTCATGGCTTCCGCATATACAACTGCGAGCCTTTCAAAGAAACTTTCAGACGC
GACCTGAAGAACGGTGGTTTCAGAATCGTGGAGATGCTTTTCCGAAGCAACATCTTGGCCCTTGTTGGCGGTGGACCTAA
CTCTCAGTACCCTTCGACCAAAGTCCTGATCTGGGATGATCACCAGAGCCGCTGCATCAGTGAATTTTCTTTTAGGTCTG
AGATTCGTGCGGTGAAGTTAAGTAGGGATTGGATTGTTGTTGTTCTTGAGCATAAGATATACGTCTACAGTTTCGTGGAC
CTGAGGCTTCTTCTTCAGATTGAAACTCACGCGAATCCGAGAGGATTGTGCTGCCTTTCTCATGACTCGGATACGTCTGT
GCTGGCTTGCCCTGGTTTACTTCGAGGAGAGATTCGAGTTGAACATTTTGGGCTTAACATGGTGCAAACCGTAAATGCGC
ATGACGCTAGTATTGCGTGTATGACCTTGACGCTTGATGGTTTGTTGCTCGCAACTGCTAGTACAAAGGGCACACTTATT
AGAATCTTCAACACAATGGACGGAACTCGTTTGCAAGAGGTAAGAAGAGGAGTAGACAGAGCAGATATTTATAGCATTGC
GCTTTCACCGAACGTGCAGTGGCTGGCAGTATCAAGCGACAAGGGGACTGTTCACATTTTCTCTCTTAGAGTTAGGGTAG
TTGGGGAGGATTCTGATTCCACTGAGAGTGCAGCTCTCTTGACTCAACAAACTTATTCTAATTCTCTGCAAGGCCTTGTT
TCTCCAGCCACTGGTACCAACCCCGGTTCGTCATTGTCTTTTATGAGAGGTGTTCTACCAAAGTATTTCAGCTCGGAATG
GTCATTTGCACAGTTCCATGTATCAGAAGTCACACAATTCTTCGCAGCATTTGGCAGTCACAACACGGTTGCTATTACCG
GCATGGATGGAAGTTTCTACAGATGCAGCTTTGATCCTGTGAATGCGGGAGAGATGGTGCAGCTTGAACATATCCACTTT
CTAAAGACTGATAACCGCCCAAGATAA