Details for Kale Locus Bo4g190470

Position : C4 ( 5`- 51254148 .. 51254738 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190470

Protein [Map View]
MFPVQGSERKGLVSVEVKNKKGQMYIMSSLRLNVALQIRASYDMKLLAVDIQMVSGPDKQLFLIGDEEVLKRKKTLKENF
KKVKESTVKRFKKLEKESS*

DNA
ATGTTCCCTGTTCAAGGTTCTGAGAGAAAGGGACTTGTTAGTGTCGAAGTTAAGAACAAGAAAGGCCAGATGTATATTAT
GTCTAGCCTAAGACTGAATGTAGCGCTGCAGATTAGAGCTTCTTATGACATGAAGCTTTTGGCCGTGGATATACAAATGG
TGTCTGGTCCTGACAAACAGTTATTTCTGATAGGCGATGAAGAAGTATTGAAGAGGAAGAAGACGCTGAAAGAGAACTTC
AAGAAGGTGAAAGAAAGCACCGTGAAGAGATTCAAGAAGCTCGAGAAAGAGAGTTCTTAA