Details for Kale Locus Bo4g190390

Position : C4 ( 5`- 51211418 .. 51212917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190390

Protein [Map View]
MDSNSNNTKAIKRKVVDDLVEGCKFTTQLRLLLSNHHIETGLLSGDSDLANELITKILGSFHKTISVLDSFDPVPDVSFP
VAVEGSRNASCGDDSAAPASCNGGDSGDSRKRLGVGKGKRGCYIRKKRSHTWTVQAKRIDEDIYAWRKYGQKEILNSKFP
RSYFRCTHKPTQGCKATKQVQKLEQNPEMFQITYMGNHTCTLGDQTQVKTEITMDSDNSLAAATPQQDHVNANVQEQEND
ISSLIVGMVKQEEDNNNGDQIKDSSEGSSTDGDLSLVWQDEMIFDDYQYHQDHYYYGETSTTSHQFSFIDNDQLSSLFDS
YCPYEGMNSR*

DNA
ATGGATTCAAATAGTAACAACACAAAAGCTATAAAGAGAAAAGTTGTAGATGACCTCGTGGAAGGCTGCAAATTCACTAC
TCAGCTTCGGCTTCTTCTCTCTAATCACCACATCGAGACGGGTTTACTCTCCGGTGATTCAGATCTCGCTAATGAGCTCA
TCACTAAGATCTTGGGATCCTTCCATAAAACCATATCGGTTCTTGATTCTTTTGACCCCGTCCCCGACGTCTCTTTCCCT
GTGGCCGTAGAGGGTTCACGAAATGCTTCATGTGGCGATGACTCGGCGGCTCCGGCGAGTTGCAACGGTGGAGATTCCGG
AGATAGTAGAAAGAGACTTGGGGTTGGTAAGGGTAAAAGAGGATGCTACATAAGAAAGAAGAGATCGCATACTTGGACCG
TGCAAGCTAAAAGAATTGATGAAGATATATATGCTTGGAGGAAATATGGACAAAAGGAGATTCTTAATTCCAAGTTCCCA
AGGAGTTACTTTAGATGCACACACAAACCAACACAAGGATGCAAAGCAACCAAGCAAGTTCAGAAACTTGAGCAAAACCC
TGAGATGTTTCAAATCACATACATGGGCAACCACACATGTACTCTTGGTGACCAAACGCAAGTGAAGACCGAGATTACCA
TGGATTCGGACAACTCATTGGCTGCAGCCACTCCTCAACAGGACCATGTCAATGCAAATGTACAAGAGCAAGAGAACGAT
ATCAGTAGTCTGATCGTAGGTATGGTGAAGCAGGAGGAGGATAATAACAATGGTGATCAGATTAAAGACTCTAGTGAGGG
TTCTTCAACTGACGGCGACTTGTCATTGGTTTGGCAAGACGAGATGATATTTGATGATTATCAATATCATCAGGATCACT
ACTATTATGGTGAGACTAGTACTACTTCTCATCAATTCTCTTTCATTGACAACGATCAACTTTCCTCCTTATTCGACTCA
TATTGCCCTTACGAAGGAATGAATTCTAGGTGA