Details for Kale Locus Bo4g190250

Position : C4 ( 5`- 51126947 .. 51129111 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g190250

Protein [Map View]
MVDLKEGMPVSSSSSSPSSSLPLSTMQIDVEMWKIAEERAQEILNTIQPICVADRSRNEIFAYVQTLARDRLGTEVFNFG
SVPLKTYLPDGDIDLTVLTPQDKEEDLAKALLSILEAESGESNFHVTDVQYVPAQVKVIKCKIKNIAVDISFNQMGGLSA
LCFLEQADQIFGRDHLFKRSIILIKAWCYYESRILGANTGLISTYALAVLVLHIINIGYPSLSGPLALSRLTYGIYYHQQ
VLFKFLDYYASFDWGKNCVTVHGPVLISSLPDMTETEHHEVVLNEKFVRECMESYSFSTKAVEANGRHFPVRYFNIVDPL
KHSNNLGRSVTQGNVQRLKHAFTLGAKKLKDVLTLPRETMGWKLENFFGNSLERNGKGQRLDVDEPITAFGTGRSELSEL
RGDFERYFQSLVYGKWFHGETHLWIPQGQDTSSWDTVNGQNNGFYWRNVNGATSLQNMGRSRGTGTFFPEMGQQSYTDGF
GSQPRTVKSLPSGSQS*

DNA
ATGGTTGATCTTAAAGAGGGGATGCCAGTCTCCTCATCTTCATCCTCCCCATCATCATCTTTGCCACTATCAACAATGCA
AATAGATGTAGAAATGTGGAAGATTGCTGAGGAAAGGGCTCAGGAGATACTAAACACCATCCAACCAATCTGTGTTGCAG
ACAGAAGTAGGAATGAGATCTTCGCTTATGTCCAAACCCTTGCCAGGGATCGTCTTGGAACTGAGGTCTTTAATTTTGGT
TCAGTGCCATTAAAAACCTATCTCCCAGATGGAGATATTGATCTGACAGTCCTAACTCCTCAAGATAAGGAGGAGGACTT
GGCTAAAGCATTGCTCAGTATTCTTGAAGCTGAAAGCGGAGAATCTAACTTCCATGTTACTGATGTTCAGTATGTCCCAG
CACAGGTCAAGGTCATAAAGTGCAAGATCAAGAACATTGCTGTAGATATCTCCTTTAATCAAATGGGAGGACTATCTGCT
TTATGTTTTCTGGAGCAGGCTGACCAAATTTTTGGGAGAGACCACCTGTTCAAACGTAGCATCATTTTGATCAAGGCTTG
GTGCTATTATGAGAGCCGTATACTCGGTGCCAACACTGGATTGATTTCAACATATGCATTGGCAGTACTAGTCTTGCATA
TTATCAACATAGGTTATCCATCACTGTCTGGCCCTTTAGCGCTTTCAAGATTAACATATGGTATCTATTATCATCAACAG
GTACTGTTTAAGTTCTTGGATTACTATGCATCATTTGATTGGGGTAAGAACTGTGTCACGGTCCATGGTCCTGTCCTGAT
ATCTTCTCTTCCAGATATGACCGAAACCGAGCATCATGAAGTTGTCTTGAACGAGAAGTTCGTTAGAGAATGCATGGAGT
CATATTCGTTTTCAACTAAAGCTGTTGAAGCAAACGGCCGTCATTTTCCTGTGAGGTATTTCAACATAGTGGATCCTTTG
AAACACAGTAACAACCTTGGCCGTAGTGTGACACAAGGCAATGTGCAACGTTTAAAACATGCTTTTACTCTAGGAGCTAA
GAAGCTCAAAGATGTGCTTACACTGCCTAGAGAAACCATGGGCTGGAAACTTGAGAATTTCTTTGGTAATTCACTGGAGA
GAAACGGTAAGGGACAAAGACTAGACGTGGATGAACCTATCACGGCTTTTGGCACTGGAAGATCAGAATTATCTGAGCTC
AGAGGAGATTTTGAAAGATACTTCCAGAGTCTTGTATATGGGAAGTGGTTTCATGGTGAGACTCATTTATGGATCCCTCA
GGGTCAGGACACAAGTTCTTGGGACACTGTGAATGGCCAAAATAATGGTTTCTATTGGAGGAATGTGAATGGAGCAACCT
CGTTGCAGAACATGGGAAGATCAAGAGGAACAGGCACTTTCTTTCCTGAAATGGGACAACAATCTTATACAGACGGGTTC
GGTAGCCAACCGAGGACAGTGAAGTCATTGCCTTCAGGGTCTCAGTCTTAA