Details for Kale Locus Bo4g012840

Position : C4 ( 5`- 1465037 .. 1467029 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g012840

Protein [Map View]
MGLRMSESAKPYFAMVCLQFGYAGMNLLTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVRSKMTFSIFMHIFVL
ALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEKVEMKKVRCQVKVVGTLVTVVGSILMILYKGPFIN
FFRSHLTTTATASSPLAGDYFKAAVFLLLASLSWATFFILQAWTLKKYAAHLSLSTMVCFMGTLQSLALAFVMEHNPSAL
NISFDMNLLASAYAGIMSSSVAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQGIYLGGVIGLVVLMVGIYAVL
WGKRVDDDDKETRCEDNILEAVKCCSGNNSLSIMPTIDEADEDVETGKVRAVEKEASLGVVVFCRENGDNVSRC*

DNA
ATGGGACTAAGGATGTCAGAATCAGCTAAACCTTACTTTGCAATGGTCTGTCTTCAGTTTGGATACGCCGGTATGAACCT
GCTCACTAAAACCGTCCTTGACCGCGGTATGAGCCATTACGTTCTTGTTGCATACCGCAACGCTTTTGCCACAGCCGCGA
TCGCACCTTTCGCATTTCTCTCTGAAAGGAAAGTGAGGTCAAAGATGACGTTTTCGATATTCATGCACATATTTGTTCTT
GCTCTTCTCGGGCCTGTGATTGATCAGAATCTATATTACATCGGTCTGAAACTCACATCTCCGACGTTTTCCTCCGCCGT
CAGCAACATCGTGCCCGCAATAACCTTTATCCTCGCCACTCTATTCAGGATGGAGAAAGTGGAGATGAAAAAAGTAAGAT
GCCAAGTAAAAGTGGTGGGGACTTTAGTGACAGTGGTTGGATCCATATTGATGATATTATACAAAGGTCCTTTCATCAAT
TTCTTCCGATCTCACCTCACCACCACCGCCACCGCATCTTCGCCGCTGGCCGGTGATTATTTTAAAGCCGCCGTCTTCCT
CCTTCTCGCTTCCCTCTCATGGGCTACCTTCTTCATTCTCCAGGCATGGACTTTGAAGAAATACGCAGCCCATCTCTCGT
TATCAACCATGGTGTGTTTCATGGGAACGTTACAATCCTTAGCCCTGGCCTTCGTAATGGAACACAATCCTTCTGCTTTG
AACATCAGTTTTGACATGAACCTTCTAGCTTCTGCCTATGCGGGAATAATGTCGTCGAGCGTAGCTTACTACGTTCAAGG
ACTTATGATGCAGAGAAAGGGACCTGTCTTCGTCACTGCTTTTAACCCTCTTGTTGTCGTCATTGTCTCCATAATGAGCT
TCTTCGTTCTCGGCCAAGGAATCTACCTAGGAGGGGTTATTGGACTGGTTGTTTTAATGGTGGGAATCTACGCCGTGTTA
TGGGGCAAACGCGTAGACGATGATGACAAAGAAACACGCTGTGAAGATAACATTTTAGAAGCCGTTAAGTGTTGTAGTGG
CAATAATAGTCTCTCGATCATGCCAACAATCGATGAAGCTGATGAGGATGTTGAAACGGGTAAAGTTCGGGCGGTTGAGA
AGGAAGCATCGCTGGGGGTTGTGGTTTTTTGCCGTGAAAATGGGGATAACGTTTCACGATGCTAA