Details for Kale Locus Bo4g012790

Position : C4 ( 5`- 1419539 .. 1422486 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g012790

Protein [Map View]
MMISQTSCFWEERLKNYNKTKDKIPTMTKVCPEMHEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEK
HPSVKDVVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDALESMRGRMDGRNKEA
VEKAISMVEALAVKLTQHEGGFIQEKAEVKKLASFLKQASEDAKKLVNQERSFACAEIESAKTLVMRLGGAFEKQEISSK
ASRAQGPNVEKLVEEVQEARRIKRMHQPTKVMGMQHELRDLKSQIQEKSAYSIKLQREIAIIKRAEGSKTCPYVLDGAQS
LGSCLKIRASSDSNASDISKCSFQWYRAASESSRREAISGANQSVYAPEPYDVGRVIQADILCNGQKFTVTTEGPINTAS
GLQSRVESLMRKSNSEFTVVISQMNGQDHVSRSHVFTVGKSRVKLSRGWITKAREIYSNSMQLCGVRGNANAHAKALFWQ
PRKGLSFLLTFESEQERNAAIVLSRKYAYDCNVTLVGQDD*

DNA
ATGATGATCAGTCAAACGAGCTGTTTTTGGGAAGAGAGACTCAAAAATTACAACAAGACCAAAGATAAGATTCCGACAAT
GACTAAAGTATGTCCTGAAATGCACGAAAAGAAAGTGTGTGAAGCAGTAGTGGTAGTTGAAGCAATTTCAGCAGATGTGA
GCTTTGCTTCTAACCAGTTTCCATCATACAAGCTAGGACCTGATGATCAGATTGTTGATGAGCCTAAAGAAAATGAAAAA
CATCCATCTGTTAAAGATGTAGTCGACAAAGAAACAGGAGATTTGTCTGATCAGCACAAGCGGCTTTCAGTTCGTGACCT
TGCTTGCAAATTCGACAAGAATCTAGCTGCAGCTGCTAAACTAGTTGATGAGGCAAAGTTGAGTGAGGTGACTTCATTGG
AAGGACATGTTATGCTAAAGAAACTTAGAGATGCTTTAGAATCCATGAGAGGTCGTATGGATGGACGTAACAAGGAAGCA
GTTGAAAAAGCTATCTCTATGGTTGAGGCTCTAGCAGTTAAGTTAACTCAACATGAAGGTGGGTTTATTCAAGAAAAGGC
TGAAGTGAAGAAACTGGCAAGCTTCCTTAAGCAGGCTTCAGAAGATGCAAAGAAGTTAGTAAACCAGGAACGTTCGTTTG
CTTGTGCTGAAATAGAGAGTGCAAAGACTCTTGTGATGAGACTTGGAGGAGCATTTGAAAAACAGGAGATTTCTTCTAAA
GCTTCTCGAGCTCAGGGTCCGAATGTGGAGAAACTGGTTGAGGAAGTTCAGGAGGCTAGAAGAATCAAAAGGATGCATCA
ACCAACCAAGGTGATGGGCATGCAACATGAGCTTCGTGATTTAAAGAGTCAAATCCAAGAGAAGTCTGCATATTCCATTA
AGCTTCAAAGAGAGATAGCAATAATCAAGAGAGCAGAAGGGTCCAAGACATGTCCTTATGTTCTAGATGGTGCACAAAGT
CTTGGCTCGTGCCTAAAGATACGTGCCTCCTCAGATAGTAATGCTTCAGATATTTCCAAATGTTCATTCCAGTGGTACCG
TGCAGCATCTGAGTCTAGTCGTAGAGAAGCTATATCTGGTGCCAACCAATCAGTATATGCTCCAGAACCATATGATGTGG
GGAGGGTAATACAAGCAGACATACTTTGTAACGGTCAGAAGTTCACTGTTACAACAGAGGGTCCAATTAATACTGCTTCT
GGCTTGCAATCACGTGTTGAATCACTCATGCGCAAATCTAACAGTGAATTCACCGTGGTTATATCACAGATGAATGGGCA
AGATCATGTATCGCGATCTCACGTCTTTACTGTCGGAAAGTCGAGGGTAAAGCTGTCTCGAGGATGGATCACAAAGGCTA
GAGAAATATATTCAAACTCCATGCAGTTATGTGGAGTGAGAGGCAATGCTAATGCTCATGCAAAAGCATTGTTCTGGCAA
CCAAGAAAGGGTCTAAGTTTCTTGCTGACTTTTGAGTCGGAACAAGAACGTAATGCAGCTATTGTTCTCTCCCGGAAATA
CGCATATGACTGCAATGTTACTCTGGTTGGGCAAGACGATTGA