Details for Kale Locus Bo4g012780

Position : C4 ( 5`- 1404595 .. 1406710 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g012780

Protein [Map View]
MASTRPDPDKLSQLGSSAPVFSDSITNVRKKKIRNSAKRRYLSSRNQNPLTPRSQIRNLSATGMVKPSDFKAIHGFIRSH
YTRVNPVTTHRSNPSSGGVASHLHTKLTSFHSLSPKPTGLSQLLSQKLQPLGLPRVKNASFAFAFRFVSTKSSGFRKVDG
SFARKVVDKPVKAVSSSFARYREAMGLHVDAFWKKNSLVLYGAGGVFVCIFLWRIMFGIASTFVGLSEGMAKYGFLALSS
AIVAFSGLYLRSRFTINPDKVYRMTMRKINTAADILEVMGAPLSGSDLRAYVMSGGGITFKKFKPTIRSKRCFLLFPVQG
SERKGLVSVEVKKKKGQYDMKLLAVDIPMASGPDQRLYLIGDEEGYKVGGGLISELRDPVVKAMAATKEFDNLDRIEEEE
DAERELQEAERKHREEIEKLEKESS*

DNA
ATGGCCTCGACCCGACCCGACCCGGATAAGCTATCCCAACTCGGATCATCCGCCCCGGTCTTCTCCGATTCGATCACCAA
CGTCAGGAAAAAAAAAATCAGAAACTCAGCAAAAAGACGATACCTTTCTTCGAGAAATCAGAACCCTTTGACTCCTCGAT
CTCAAATTCGAAACCTTTCAGCTACAGGGATGGTGAAACCATCGGATTTCAAAGCAATCCACGGCTTTATCCGGTCACAT
TACACCCGGGTCAACCCGGTCACCACCCACCGGTCAAACCCATCGAGCGGTGGTGTTGCTTCCCACCTCCACACCAAGCT
CACCTCCTTCCACAGCTTATCGCCCAAACCCACTGGCTTATCTCAGCTCCTCTCTCAAAAGCTTCAACCTTTGGGTTTGC
CACGTGTGAAAAACGCGAGCTTTGCGTTTGCGTTTAGGTTTGTGTCCACTAAGAGCTCTGGGTTTCGAAAAGTTGATGGG
AGCTTTGCGAGGAAGGTTGTTGATAAGCCTGTGAAAGCTGTTAGCTCTAGCTTCGCTAGGTACCGTGAGGCTATGGGTTT
GCACGTTGACGCGTTCTGGAAGAAGAACAGTCTTGTTTTGTATGGAGCTGGTGGTGTGTTTGTGTGTATCTTCCTTTGGA
GGATTATGTTTGGGATCGCGAGTACCTTTGTTGGGCTCTCTGAGGGCATGGCTAAGTATGGGTTTCTAGCTCTCTCCTCA
GCCATTGTAGCGTTCTCTGGACTATACCTGCGGTCAAGGTTCACAATAAACCCGGATAAAGTTTACAGGATGACAATGAG
GAAGATCAACACAGCAGCTGACATTCTGGAAGTAATGGGTGCTCCTCTGTCAGGATCAGATTTGAGAGCTTATGTGATGT
CAGGTGGTGGCATAACATTCAAGAAATTCAAGCCAACGATTAGGAGCAAGCGTTGCTTTCTCCTGTTCCCTGTTCAAGGC
TCTGAGAGAAAGGGTCTTGTTAGCGTCGAAGTTAAGAAGAAGAAAGGCCAGTATGACATGAAGCTTTTGGCGGTGGACAT
TCCAATGGCATCTGGTCCTGACCAACGGTTATATCTGATTGGGGATGAAGAAGGGTACAAAGTGGGTGGTGGTTTGATCT
CTGAGTTAAGAGACCCTGTTGTGAAAGCCATGGCAGCGACCAAGGAGTTCGATAACCTTGACAGAATTGAAGAGGAAGAA
GACGCTGAAAGAGAACTTCAAGAAGCTGAAAGAAAGCACCGTGAGGAGATTGAGAAGCTCGAAAAAGAGAGCTCTTAA