Details for Kale Locus Bo4g012750

Position : C4 ( 5`- 1390415 .. 1392079 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g012750

Protein [Map View]
MDPNSNNTKSIKRKVVDQLVQGYEFATQLQLLLSHQHSSQYISQTRIVSGDLDPVDELIAKILSSFHKTISVLDSCDSVP
MAIEGSPNASRGDDLAAPVSCNGGDSGDSRKRLGVGKGKRGCYTRKKRWHTWTVEASRIDEDKYAWRKYGQKEILNSKFP
RSYFRCTHKQTRGCKATKLVQKQEQDPSLFQITYIGHHTCNVSDQTHANTEPNDHGVVMDSDNALAATIAQDHVNANIQE
QEQENDISSLIVVGAGMVKEEDNNNGDQNKNYCEGSSVDGDLSLAWQDVMMMFDDHQHHQNHYYQGETSTASHQFSFIDN
DQLFSLLDPYCPYEGSNAI*

DNA
ATGGATCCAAATAGTAACAACACCAAATCCATAAAGAGAAAAGTTGTCGACCAACTCGTCCAAGGCTACGAGTTCGCTAC
TCAGCTTCAGCTTCTCCTCTCTCATCAACATTCAAGTCAGTACATCAGTCAGACCCGTATTGTTTCTGGCGATCTGGATC
CAGTTGATGAGCTCATCGCTAAGATCTTGAGTTCTTTCCACAAAACCATATCGGTTCTTGATTCTTGTGACTCCGTCCCT
ATGGCCATTGAGGGTTCACCGAATGCTTCACGTGGTGATGATTTGGCGGCTCCTGTGAGTTGCAACGGTGGAGATTCCGG
GGATAGTAGGAAGAGACTTGGGGTTGGTAAGGGCAAAAGAGGATGCTACACTAGAAAAAAGAGATGGCATACTTGGACTG
TGGAAGCTAGTAGAATCGATGAAGACAAATATGCTTGGAGGAAATATGGACAAAAAGAGATTCTTAATTCCAAATTCCCA
AGAAGTTACTTTAGATGCACACACAAGCAAACACGAGGATGCAAAGCAACGAAGCTAGTTCAAAAACAAGAGCAAGACCC
TAGTTTATTTCAAATCACATACATTGGCCACCACACATGTAATGTTAGCGACCAAACACACGCAAATACCGAGCCTAATG
ATCACGGAGTAGTCATGGATTCGGACAACGCATTGGCTGCAACCATTGCTCAAGACCATGTTAATGCAAATATACAAGAG
CAAGAGCAAGAGAACGACATCAGTAGTCTGATTGTAGTAGGTGCAGGCATGGTGAAGGAGGAGGACAATAACAATGGTGA
TCAGAATAAAAACTATTGTGAGGGTTCTTCCGTAGATGGTGATTTGTCATTGGCTTGGCAAGACGTGATGATGATGTTTG
ATGATCATCAACATCATCAGAATCATTACTATCAAGGTGAAACTAGTACTGCTTCTCATCAGTTCTCTTTCATTGACAAC
GATCAACTCTTCTCCTTACTCGATCCATACTGCCCTTACGAAGGATCAAATGCCATATGA