Details for Kale Locus Bo4g012650

Position : C4 ( 5`- 1332528 .. 1334625 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo4g012650

Protein [Map View]
MADLQERMSLSSSSSSSSSSSSSSLSLSTMPIDGELWMVAEERAQEILNAIQPVFVSDKSRNEIIDYVQTLVKDRLGIEV
FLFGSVPLKTYLPDGDIDLTVLTPQDKEEDLANALCNMLRAEDKESDFHVTDVQYIPAQVKVIKCSIRNIAVDISFNQMA
GLCALCFLEQVDQIFGKDHLFKRSIILIKAWCYYESRILGANTGLISTYALAVLVLHIINISYSSLSGPLAVLFKFLDYY
ASFDWDSYCVTVNGPVPISSLPDMPSNDAEVVLNEKFFRECIELYSVPTKAVEANGHYFPVKHFNIVDPLKHTNNLGRSV
TKGNLQRIRHAFTLGARKLKDVLSVPGEAMGWKLEKFFCSSLERNGKGQRQDVEEPVVAFGTGRAEASELRGDFEGYFKS
LVYGKGFHGETQHKWIPQGQGQDHTSSWDIVRWFVAGQKNDFHRRNMNGSSNSLQNMRRSRGTGTYIPEMSQQSYTERFS
GKPSTVNPLPSASQSQLVKQNI*

DNA
ATGGCTGATCTTCAAGAGAGGATGTCACTCTCCTCATCTTCATCCTCCTCCTCCTCATCATCATCGTCTTCTCTGTCACT
ATCAACAATGCCAATAGATGGAGAGCTCTGGATGGTTGCCGAGGAAAGGGCTCAGGAGATACTTAACGCCATCCAACCTG
TCTTTGTTTCAGACAAAAGCAGGAACGAGATCATCGATTATGTCCAGACCCTTGTTAAAGATCGTCTTGGAATTGAGGTC
TTCTTGTTTGGCTCGGTGCCACTAAAAACATATCTACCAGATGGAGATATTGATCTGACAGTCCTAACTCCTCAAGATAA
AGAGGAGGACTTGGCTAACGCATTGTGCAATATGCTTAGAGCCGAAGACAAAGAATCTGATTTCCATGTGACTGACGTTC
AATACATCCCAGCACAGGTTAAGGTCATAAAATGCAGTATCAGGAACATTGCTGTAGACATCTCCTTCAATCAAATGGCT
GGACTCTGCGCTTTATGTTTCTTAGAGCAGGTTGACCAGATTTTTGGGAAGGACCATCTGTTCAAGCGTAGCATCATCTT
GATCAAAGCTTGGTGCTACTATGAGAGCCGCATCCTCGGCGCCAACACTGGATTGATTTCGACTTATGCATTGGCAGTAC
TAGTCTTGCATATCATCAACATCTCTTATTCATCACTCTCTGGCCCTTTAGCTGTGCTGTTTAAGTTCTTGGATTACTAT
GCATCATTTGATTGGGACAGCTACTGTGTAACTGTCAACGGTCCAGTCCCCATATCTTCTCTGCCTGATATGCCTAGTAA
TGACGCTGAAGTTGTCCTGAACGAGAAGTTCTTCAGAGAGTGCATTGAGTTGTATTCGGTTCCAACTAAAGCTGTTGAAG
CAAATGGTCATTACTTTCCTGTGAAGCATTTCAACATAGTGGATCCTTTGAAGCACACTAACAACCTCGGCCGTAGTGTG
ACAAAAGGCAATTTGCAACGTATAAGACATGCTTTTACTCTGGGAGCTAGGAAGCTCAAAGATGTGCTCTCAGTGCCTGG
AGAAGCCATGGGATGGAAACTGGAGAAGTTCTTTTGTAGCTCGTTGGAGAGGAACGGCAAGGGACAGAGACAAGACGTGG
AGGAGCCTGTCGTGGCGTTTGGCACTGGGAGAGCAGAAGCGTCTGAGCTCAGAGGAGACTTTGAAGGATACTTCAAGAGT
CTTGTTTATGGGAAAGGGTTTCACGGAGAGACTCAGCATAAGTGGATCCCTCAGGGCCAGGGGCAAGACCACACAAGTTC
TTGGGACATTGTCCGTTGGTTTGTGGCCGGACAAAAGAATGATTTCCATCGGAGGAATATGAATGGTTCATCAAACTCGT
TGCAGAACATGAGGAGATCAAGAGGGACAGGCACTTACATTCCTGAAATGAGTCAGCAATCTTATACAGAGAGGTTCAGT
GGCAAACCGAGCACGGTGAACCCATTGCCTTCAGCATCTCAGTCTCAACTTGTCAAACAGAATATTTGA