Details for Kale Locus Bo3g184740

Position : C3 ( 5`- 64210553 .. 64212689 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g184740

Protein [Map View]
MATVSVSSSLVRAALDTTKPKLRYNPNAPRNVKINPNSTTSFVPPSSSPAVTVLTTTSVSVSDLLKRPASKGDDEDSCVG
YEKWFPSPPKVKKPRSVFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLHNLLDEDFLTKDER
EILRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLANGKRLEEIMQKLGFSSGSSTEIMVKEAKHKLSSLK*

DNA
ATGGCGACTGTATCAGTAAGCTCTAGTCTGGTGAGAGCTGCTTTAGATACTACGAAGCCTAAGCTCCGTTACAATCCCAA
TGCGCCGCGTAACGTCAAGATAAACCCTAATTCTACTACCTCTTTCGTTCCTCCATCGTCTTCTCCGGCGGTGACAGTCT
TGACAACTACTAGCGTTTCCGTTTCTGATTTGCTCAAACGTCCCGCAAGCAAAGGTGATGATGAAGATAGTTGTGTTGGA
TATGAGAAATGGTTTCCAAGTCCACCGAAAGTGAAGAAGCCTAGATCCGTCTTCAATGCTGCCTCGCTAGCTTATATAGG
CGATTCCATCTACGAGATATACGCTCGTCGCCATTTTCTTTTCCCTCCACTGAGTATTGAAGAATATAACGACCGTGTTC
GAGCAGTGGTGCGATGTGAAGCACAATATGCTTTGCTGCATAATCTCCTTGATGAGGATTTCTTAACTAAAGATGAAAGA
GAGATACTTCGGTGGGGAAAAAACGTAGGCTCGGTTAAAACACGGTCAACTAGGCGTGCTGGTGTTGCGGTTTATAACAA
GGCCTCGTCATTGGAAACACTTATTGGCTATTTGTATCTAGCAAACGGCAAGAGATTAGAAGAAATAATGCAGAAGCTGG
GGTTCTCAAGTGGTTCTTCAACAGAGATAATGGTTAAGGAGGCCAAGCATAAACTATCATCTTTAAAATAA