Details for Kale Locus Bo3g184730

Position : C3 ( 5`- 64197878 .. 64199838 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g184730

Protein [Map View]
MMMNKDMLYHHQQQQVEENMSNLTSASGDRASVSSGNRTETSGSNFHYNTNPNQQQEEQCLAPQPSQKKKRNQPGNPDPE
AEVLALSPKTLMATNRFICEICNKGFQRDQNLQLHKRGHNLPWKLKQRSNKDVIRKKVYVCPEPNCVHHHPSRALGDLTG
IKKHFFRKHGEKKWKCDKCSKKYAVQSDWKAHAKTCGTKEYKCDCGTLFSRRDSFITHRAFCDALAEESARAIPNPILIP
SSSPHQTQHNINFSSSSQNITSHNNNPHGHDELPMKQEEPHHHFHNIPPWLISSNPNPNGNNANYFPLASASANFQHPSP
AMSATALLQKAAQMGPSKSTTTPEEDEKSSYNKLITTTMAASMMTSPSEPGFGFQDYYMMNHHAHHHDGVGEAFDGGFNA
GDERNDVVDDSGGETRDFLGLRPLMSHNEMLSFANNLGNCINTSASEQQQRYSHQD*

DNA
ATGATGATGAACAAAGATATGTTATATCATCATCAACAACAACAAGTGGAGGAAAACATGTCCAATCTAACATCAGCTTC
AGGAGATCGTGCAAGTGTGTCTTCAGGAAACAGAACTGAGACTAGCGGCTCCAACTTTCATTACAACACTAATCCAAATC
AGCAACAGGAAGAACAGTGTCTTGCTCCACAACCATCTCAAAAGAAGAAGAGAAACCAACCCGGCAATCCAGACCCAGAA
GCAGAAGTGTTGGCTTTATCACCAAAAACACTAATGGCAACAAACAGATTCATATGCGAGATCTGCAACAAAGGGTTTCA
AAGAGACCAGAACTTGCAGCTTCACAAGAGAGGACACAATCTACCATGGAAGCTTAAACAAAGATCAAACAAAGACGTGA
TAAGGAAGAAAGTCTATGTCTGCCCCGAGCCAAACTGTGTCCATCATCATCCATCAAGAGCTCTAGGAGACTTGACAGGA
ATCAAGAAGCATTTCTTCAGAAAACATGGCGAGAAAAAATGGAAATGCGATAAGTGTTCGAAGAAGTATGCGGTGCAATC
AGATTGGAAGGCTCATGCTAAGACTTGTGGCACCAAAGAATACAAATGCGACTGTGGAACTCTCTTTTCTAGGAGGGATA
GCTTCATAACTCATAGAGCATTTTGTGATGCATTAGCAGAAGAGAGTGCAAGAGCCATACCAAACCCTATTCTAATCCCA
TCTTCTTCTCCTCATCAAACTCAACACAACATAAACTTCTCTTCCTCCTCACAAAACATCACCAGCCACAATAACAATCC
CCATGGTCATGATGAACTTCCTATGAAGCAAGAAGAGCCACATCATCACTTCCACAACATCCCTCCTTGGCTCATCTCAT
CAAACCCTAACCCTAATGGCAACAATGCTAATTACTTCCCTCTTGCTTCTGCTTCAGCAAACTTCCAGCACCCATCTCCG
GCTATGTCAGCCACAGCTTTGCTCCAGAAAGCAGCTCAAATGGGTCCCTCAAAGTCAACAACCACTCCAGAGGAAGACGA
GAAGTCGAGCTATAATAAGCTGATCACAACTACAATGGCTGCATCGATGATGACGTCACCTTCAGAACCTGGATTCGGGT
TTCAAGACTACTATATGATGAATCATCATGCTCATCATCATGACGGCGTTGGAGAAGCTTTCGACGGTGGTTTTAACGCC
GGAGATGAGAGGAACGATGTGGTGGACGACAGTGGAGGAGAGACTAGAGATTTCTTGGGGTTAAGACCGTTAATGTCTCA
TAATGAGATGCTAAGTTTCGCTAATAATCTTGGCAACTGTATCAACACGTCTGCTTCAGAGCAACAACAACGATACAGCC
ATCAAGATTAG