Details for Kale Locus Bo3g184680

Position : C3 ( 5`- 64158338 .. 64162652 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g184680

Protein [Map View]
MRLLKVATCNLNQWAMDFECNMSNIKASIVQAKAAGAAIRLGPELEVTGYGCEDHFLELDTVTHAWDCLKELLLGDWTND
ILCSIGMPVIKGAERYNCQVLCMNKRIIMIRPKMCLANDGNYRELRWFTAWKQRGELEEFHLPIEISEALSQESVPFGYG
YIQFIDTAVAAEVCEELFSPVPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYSNQQGCDGGRLY
YDGCACIVVNGDVVAQGSQFSLKDVEVITSQVDLDAVASLRGSVSSFQEQASCKVKVSSVYVPCKLTQSFNLKMTLSSPK
KIMYHSPQEEIAFGPACWLWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIANGDEQVKTDAKRIGNYTNGE
FPTDSKEFAKRIFYTVFMGSENSSEATKMRAKQLADEIGAWHLDVCIDGVVSAVLTLFQTVTGMRPRYKVDGGSNVENLG
LQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKQDLRLFLRWAATNLGY
QSLAEIEAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFK
YYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQFKKIDEIVDGLNGDSVAFPGEEASYGKEVGVVAANSGD
PSAGL*

DNA
ATGAGGCTTTTGAAAGTAGCGACGTGTAACTTGAACCAATGGGCTATGGACTTCGAATGCAACATGAGTAACATCAAGGC
TTCCATTGTCCAGGCTAAGGCTGCCGGTGCCGCCATCAGGCTTGGTCCTGAGCTTGAGGTCACTGGTTATGGCTGTGAGG
ATCACTTCTTGGAGCTAGACACCGTCACTCACGCGTGGGATTGTTTAAAGGAATTGCTGCTTGGTGATTGGACTAATGAT
ATATTATGTAGCATAGGAATGCCTGTGATTAAAGGAGCAGAGCGGTATAACTGTCAGGTTCTCTGTATGAACAAAAGAAT
CATCATGATTCGACCAAAGATGTGCCTCGCCAACGATGGAAACTACAGGGAGCTGAGGTGGTTCACGGCTTGGAAGCAGA
GAGGAGAGCTCGAAGAGTTTCACCTCCCCATTGAAATCTCAGAGGCCTTGTCACAGGAATCCGTTCCTTTTGGATATGGT
TACATCCAGTTTATCGACACAGCTGTTGCAGCTGAAGTCTGTGAGGAACTGTTTAGTCCAGTTCCTCCTCATGCTGAGCT
TGCGTTGAACGGTGTGGAGGTGTTTATGAATGCGAGTGGGAGTCATCACCAGCTAAGAAAGCTTGATATTCGTTTGAATG
CTTTCATGGGGGCTACTCACGCTCGCGGTGGGGTTTATATGTACAGTAATCAACAGGGATGCGATGGTGGCCGCTTATAC
TACGATGGATGTGCATGCATTGTTGTAAACGGAGATGTTGTAGCTCAAGGCTCACAGTTCTCGTTGAAGGACGTTGAGGT
CATCACTTCCCAAGTGGATCTAGATGCGGTTGCTAGTCTTCGCGGATCGGTAAGTAGTTTTCAGGAACAGGCAAGTTGTA
AAGTGAAAGTATCTTCAGTATACGTGCCCTGTAAGCTGACACAGTCCTTCAACCTAAAAATGACACTAAGCAGTCCGAAG
AAGATTATGTACCATTCTCCACAAGAAGAGATAGCCTTTGGTCCTGCTTGCTGGCTATGGGACTATTTGAGAAGAAGCGG
AGCTTCAGGGTTCTTGCTTCCTCTTTCTGGTGGAGCAGACAGCTCGTCTGTGGCAGCTATTGTTGGCTGCATGTGCCAAC
TTGTTGTTAAAGAGATTGCAAATGGAGATGAGCAAGTGAAAACTGATGCGAAACGGATTGGGAACTATACTAATGGAGAG
TTTCCTACTGATAGCAAAGAGTTTGCTAAGCGAATATTTTACACTGTGTTTATGGGGTCTGAAAACAGTTCTGAGGCGAC
AAAAATGCGTGCAAAGCAGCTGGCAGACGAGATCGGTGCATGGCATCTTGATGTTTGCATAGATGGCGTTGTCTCTGCGG
TTCTAACTTTATTTCAAACGGTTACTGGCATGCGTCCTCGGTATAAGGTTGATGGAGGATCAAACGTTGAGAATCTTGGG
TTGCAGAACATTCAAGCACGGATGAGAATGGTGTTAGCGTTTATGTTAGCGTCTCTCTTGCCTTGGGTTCATAGCAAACC
AGGCTTTTACCTTGTTCTAGGCAGCTCCAATGTTGATGAAGGACTTCGTGGTTACCTGACAAAGTATGATTGTAGCTCAG
CAGACATAAACCCCATAGGAAGTATTAGTAAACAGGATCTGAGGTTGTTCCTAAGATGGGCTGCAACGAATCTCGGTTAT
CAGTCCTTGGCAGAGATAGAAGCTGCTCCACCAACAGCTGAGCTTGAGCCCATTCGTTCTGACTATTCTCAGCTTGATGA
AGTCGACATGGGAATGACATATGAAGAGCTCTCAGTCTATGGAAGGATGAGGAAGATATTCCGGTGTGGCCCAGTTTCCA
TGTTCAAGAATCTATGTTACAAGTGGGGAACAAAGCTAAGCCCAGCAGAAGTAGCTGAGAAAGTGAAGTACTTCTTCAAG
TATTATTCGATCAATCGACACAAGATGACTGTCCTCACACCGTCCTACCACGCTGAGAGTTACTCTCCAGAGGACAACAG
GTTCGATCTGAGGCAGTTTCTGTATAATAGCAAGTGGCCATACCAGTTCAAGAAGATTGACGAGATTGTTGACGGCCTAA
ATGGTGACTCAGTTGCTTTTCCAGGAGAAGAAGCAAGCTACGGCAAAGAAGTTGGAGTCGTGGCTGCAAATTCCGGTGAT
CCAAGCGCGGGTCTCTGA