Details for Kale Locus Bo3g184670

Position : C3 ( 5`- 64156418 .. 64157480 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g184670

Protein [Map View]
MDQFSGGGNWSMIPNVQSQGNFGTSTNQDHLFLQQQQQQQQPQQFHHPQQQTQQQQFQPQQQQQQEMQFQQFQQQQFIQQ
QQFHHQQHRLLHSPQQQQPQSSLQSPPPQQTVVHTPQSMMHTPQQQQQLVHTPQQSVQTPQQHQSLASHFHLYPLVEKLS
DAVETGTRDQNSDALVSELNGHFDKCQQLLNSISGSLGSKTTMTVDGQKRNLEESEQLLQQRRDLIMEYRKSIEDLVKIE
P*

DNA
ATGGATCAGTTCTCAGGAGGAGGCAATTGGTCGATGATCCCCAACGTTCAGTCGCAGGGTAACTTCGGTACATCCACCAA
TCAAGACCATCTATTCCTCCAGCAACAGCAACAACAACAACAACCACAACAGTTTCATCATCCACAACAACAAACCCAGC
AGCAGCAATTCCAGCCACAACAACAACAACAACAAGAGATGCAGTTCCAGCAATTCCAACAACAACAGTTCATTCAACAG
CAGCAGTTCCATCACCAGCAGCACCGTCTGCTACATTCTCCTCAGCAGCAGCAGCCGCAATCGTCTTTGCAATCCCCTCC
GCCGCAGCAGACGGTGGTTCATACTCCGCAATCGATGATGCACACACCGCAGCAGCAGCAACAGTTGGTGCATACTCCGC
AGCAATCGGTTCAGACTCCGCAGCAGCACCAGTCTTTAGCTTCCCATTTCCATCTCTATCCGTTGGTGGAGAAACTATCA
GATGCAGTTGAAACTGGAACACGAGATCAGAACTCTGATGCCCTGGTGAGTGAATTGAACGGTCATTTTGACAAGTGTCA
ACAGCTGTTAAATTCGATTTCAGGATCTCTAGGATCTAAAACTACTATGACTGTAGATGGACAAAAGAGAAATCTAGAAG
AAAGTGAGCAACTGCTTCAACAAAGAAGGGACTTGATTATGGAATATAGGAAATCTATTGAAGACCTTGTCAAGATAGAG
CCTTAG