Details for Kale Locus Bo3g137280

Position : C3 ( 5`- 50105690 .. 50107261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137280

Protein [Map View]
MSSGSDKDRETFVYLAKLSEQAERYDEMVETMKKVAKVDSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGN
ESNVKQIKGYRQKVEDELADICKDILTIIDQHLIPHATSGEATVFYYKMKGDYYRYFAEFKTEQERKEASEQSLKGYEAA
TQAASTDLPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDL
PEDGGEDNIKTDEAKQEPAKPAEATEVTNLTDQRLWKLNEFRFDAQKGEDNSFEFHSLVLSRRCDQKQLNSILYSFSFIT
FLLFILLS*

DNA
ATGTCGTCAGGATCCGACAAAGACCGAGAGACATTCGTCTACTTGGCTAAGCTCTCCGAACAGGCCGAGCGATACGACGA
GATGGTGGAGACAATGAAGAAAGTGGCGAAGGTGGACAGCGAGCTGACGGTTGAGGAGAGGAATCTGTTGTCGGTTGGTT
ACAAGAACGTGATCGGAGCAAGACGTGCCTCGTGGAGGATAATGTCATCCATCGAGCAGAAGGAAGAGTCCAAGGGCAAC
GAATCAAACGTGAAACAAATCAAGGGTTATCGCCAAAAGGTAGAAGACGAGCTTGCTGACATCTGTAAAGATATTCTCAC
TATCATTGATCAGCATCTCATCCCTCACGCTACTTCAGGAGAAGCTACCGTTTTCTATTACAAGATGAAAGGTGATTATT
ACCGTTACTTTGCTGAGTTTAAGACTGAACAAGAGAGGAAGGAAGCTTCTGAACAGTCGCTCAAAGGCTATGAGGCTGCA
ACACAAGCTGCAAGCACTGACCTTCCTTCGACCCATCCGATTCGTCTTGGACTTGCTCTTAACTTCTCTGTTTTCTACTA
TGAGATCATGAACTCTCCTGAAAGAGCTTGCCATTTGGCGAAGCAAGCCTTTGACGAGGCGATTGCAGAGTTGGATACTC
TAAGTGAGGAGTCGTACAAGGACAGCACTTTGATCATGCAGCTCCTGAGAGACAACCTTACCCTCTGGACTTCTGATCTT
CCAGAAGATGGAGGAGAAGACAACATTAAGACCGATGAAGCCAAGCAAGAACCGGCTAAGCCTGCAGAAGCCACTGAGGT
GACTAACCTAACTGATCAAAGGCTCTGGAAGTTGAATGAGTTTAGATTTGATGCCCAGAAGGGGGAGGACAATTCCTTTG
AATTCCATAGCTTGGTTTTATCAAGAAGATGTGATCAGAAACAATTGAATTCAATCCTATATTCATTTTCTTTTATTACC
TTTTTGTTATTTATTTTGTTGTCATGA