Details for Kale Locus Bo3g137220

Position : C3 ( 5`- 50092714 .. 50093053 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137220

Protein [Map View]
MVGNLLIISLRGLSQIAAEYSECPSGKKGGDLGWFPRGKMAGPFQDVAFNTPVGVTSAPFKSTHGYHIILSEGRKY*

DNA
ATGGTGGGGAATCTTCTTATCATATCTTTGCGTGGACTGTCCCAGATTGCAGCAGAGTACTCGGAGTGCCCATCAGGGAA
AAAAGGAGGAGATCTTGGATGGTTCCCTAGAGGAAAGATGGCAGGTCCATTCCAAGATGTCGCCTTCAACACACCTGTTG
GTGTCACTAGTGCACCTTTCAAATCTACGCATGGATACCACATCATCTTGTCGGAAGGAAGGAAATACTGA