Details for Kale Locus Bo3g137170

Position : C3 ( 5`- 50067659 .. 50068891 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137170

Protein [Map View]
MGFKRPLDDNKFHELPFKHSRQLGFNDKSMQFEESSQSTLATVDEGDLLKPQGGETFDEESSFAYLGLDVEGCIDPVMED
CHREDATHSPRTFAPVETFYSFLLDQPARKQVPIGPDHQAMIHEWEGSLNGNLEPLGTGTCVIPMPAHMDDNIDMGSIRC
VRQHVKESREDMVKVLGSEKFRDMGFCDMGEEVAQRWCDEDALLFHEIVYSYPVTLGQNFWKHLEAVFLSRTKHEIVSYY
FNVFVPRRRAVQNRSLILDIDSDDDEWHGGSGGGPLGAQYVEEDGEEEDFAVDSPLHQETEKFNEKVHPLHQDEVGSISD
NDEDDTREGGSGLCDEHKMNAGYMDMFSGCNEERLNVEDDSCLTL*

DNA
ATGGGATTCAAACGCCCTTTAGATGACAACAAGTTTCATGAGCTCCCATTTAAACACTCTAGACAGCTTGGCTTTAACGA
CAAGTCTATGCAGTTTGAAGAGTCTTCGCAGAGTACTCTTGCCACGGTGGATGAGGGAGATCTTTTGAAACCCCAAGGAG
GTGAAACCTTTGATGAAGAGTCCAGTTTTGCTTACCTGGGTCTTGACGTGGAAGGTTGTATTGATCCGGTTATGGAAGAT
TGCCACAGAGAAGATGCAACTCACTCTCCAAGAACGTTTGCTCCTGTTGAGACTTTCTATTCTTTCCTCTTGGATCAACC
TGCTAGAAAGCAAGTGCCCATTGGACCAGATCATCAAGCCATGATTCATGAATGGGAAGGTAGTCTAAATGGGAACCTAG
AACCTCTAGGCACTGGTACATGTGTTATTCCCATGCCGGCACATATGGATGACAACATTGACATGGGTTCTATAAGGTGT
GTGCGCCAGCATGTTAAAGAATCTAGAGAAGACATGGTTAAGGTGCTTGGATCTGAGAAATTCAGAGACATGGGCTTCTG
TGATATGGGAGAAGAAGTTGCACAGAGGTGGTGCGATGAAGATGCACTACTCTTTCATGAGATTGTTTATTCCTATCCAG
TGACGTTAGGTCAGAACTTTTGGAAGCACTTGGAAGCTGTGTTTTTATCTCGAACCAAGCACGAGATTGTTAGCTACTAC
TTTAACGTTTTTGTTCCTAGAAGAAGGGCCGTTCAGAATAGGTCTTTGATATTGGACATTGATAGTGATGATGATGAATG
GCATGGAGGTTCTGGAGGAGGACCTTTGGGTGCTCAATATGTCGAAGAAGACGGTGAAGAAGAAGACTTTGCTGTCGATT
CTCCTCTTCATCAAGAGACTGAAAAGTTCAATGAGAAAGTGCATCCACTTCATCAGGATGAAGTTGGCAGTATTAGTGAC
AATGATGAAGATGATACCAGAGAAGGTGGTAGTGGACTGTGTGATGAGCACAAGATGAATGCTGGGTATATGGATATGTT
TTCTGGGTGCAATGAGGAGAGATTGAACGTGGAAGATGACTCATGCTTGACCTTATGA