Details for Kale Locus Bo3g137120

Position : C3 ( 5`- 50043931 .. 50044281 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137120

Protein [Map View]
MSTTHLNRSILISLLLLLLLLTTSITYPTAEVNRTMTSRNFRYRTHRFIPRVHLPYYVTPCDSFSRPYARSMCLELQRIH
RSSWKQPLVSPPPPEIDPRYGVDKRLVPSGPNPLHN*

DNA
ATGTCCACGACACACCTGAACCGTTCGATCTTGATCTCTCTCCTCCTCCTCCTCCTCCTTCTCACAACTTCCATCACTTA
TCCAACCGCAGAAGTAAACCGGACGATGACATCAAGAAACTTCCGTTACCGAACTCACCGATTCATCCCGAGGGTTCACC
TCCCGTATTACGTGACTCCTTGTGACTCCTTCTCTCGTCCTTACGCGCGTTCTATGTGCCTTGAGCTTCAAAGGATCCAC
CGTAGCAGCTGGAAGCAGCCACTTGTTTCCCCTCCTCCGCCGGAGATCGATCCAAGGTACGGCGTCGATAAAAGACTCGT
TCCCTCCGGTCCAAATCCTCTTCACAACTAA