Details for Kale Locus Bo3g137100

Position : C3 ( 5`- 50038277 .. 50040349 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137100

Protein [Map View]
MPFLRTRVKRNLVDEAKGNNSTEDMNLSDHNTSSENATKRQLPVFLLPNSTSQACNASPVKARRKMIDLQLPAHMYLDTD
ETDDNTICAPYKRSKSGRGDDASHQSNPSGSCLDVKNSTGLLADLNEPLTLQDSEPLALSRDTYSHYRRHNADVEGHWSE
KNTSQNGWMVLDAGHGGSTQSQRDLHIPSRSDNAVQPQRQSYPPTDYSNVTFSRERAHRELEARSVNPQASYDSYVESSV
ASYECSAGLPWLKPKLPCKIEVSNGFLDLNASTNQFTDGLNSVSPQKSLRSSASCSNNANTVRVEKHTSLLSHSLCIADQ
HKEMNHLLKRDFDINLPCDDASVSVDKHGAKAFCLKKEGENKAANIRHCFDLNACASEDDEGSGLHSSLRVKTKGTFSID
LEAPPTLQSEEEEEEDGESSQDELIKVAAAEAIVAISLSDHPDDAASSSSTDVASKSPLSWFADIITSCSDELERKIDGS
GEENSSGEIDYFEAMTLSLHPTKEEDYMPEPLVPENMIFEGTGLNKPRRGKARRGRPKRDFQRDTLPGLSSLSRHEVTED
IQLFSGLMRSRESTSGGDSRATGWGKATRRPRRQRCPPPATVILT*

DNA
ATGCCGTTTTTAAGAACCAGAGTTAAGAGGAATTTGGTGGATGAAGCAAAGGGAAATAACTCAACTGAAGATATGAATTT
GAGTGATCATAATACATCATCTGAGAATGCAACTAAAAGACAGCTTCCTGTGTTTCTCTTACCAAACTCAACTTCACAAG
CTTGCAACGCTAGTCCTGTTAAGGCCAGGAGGAAAATGATTGACCTTCAACTCCCTGCACACATGTATCTTGATACGGAT
GAGACCGATGATAATACGATCTGCGCTCCATATAAACGCTCTAAATCTGGAAGAGGGGATGATGCTTCTCATCAGAGCAA
CCCTTCAGGATCTTGCTTAGATGTGAAGAACTCAACTGGCTTATTAGCTGACTTGAATGAGCCACTCACATTGCAAGATT
CAGAACCTCTTGCGCTCTCCAGGGATACCTATTCTCATTATAGGAGACACAATGCAGATGTTGAAGGGCACTGGTCGGAG
AAAAACACAAGTCAAAATGGATGGATGGTCCTTGACGCAGGGCATGGCGGAAGCACTCAGAGTCAGAGAGACCTGCATAT
ACCTTCCCGTTCTGACAATGCAGTTCAACCTCAGAGGCAGAGCTATCCTCCGACTGATTATAGCAATGTAACATTCTCCC
GGGAAAGAGCACATCGTGAGCTGGAAGCTCGTTCAGTGAATCCTCAAGCTTCTTATGATAGCTACGTGGAATCAAGTGTG
GCTTCTTATGAATGCTCAGCTGGATTGCCCTGGCTAAAACCTAAGCTCCCTTGCAAAATTGAAGTATCCAATGGCTTCTT
GGACTTGAATGCATCAACAAATCAATTCACAGATGGCCTGAATAGTGTTTCCCCTCAGAAAAGTTTGAGATCATCTGCTT
CATGCTCTAACAATGCCAACACTGTAAGAGTTGAGAAGCATACTTCCCTTCTCTCTCACTCCTTGTGCATCGCTGATCAG
CATAAGGAAATGAACCACTTGTTAAAGCGAGACTTCGATATCAACTTGCCATGTGATGATGCCTCGGTTTCTGTTGACAA
GCATGGTGCTAAAGCCTTTTGTCTTAAAAAGGAAGGAGAGAACAAAGCTGCCAACATCAGACACTGCTTTGATTTGAATG
CATGTGCTAGTGAGGATGATGAAGGTTCAGGCTTACATTCTAGTCTAAGAGTGAAAACAAAAGGAACTTTTTCGATAGAT
TTGGAAGCTCCCCCCACTCTCCAGAGTGAAGAAGAAGAAGAAGAAGATGGAGAGAGCTCGCAGGATGAACTCATCAAGGT
AGCAGCAGCAGAAGCAATAGTCGCCATTTCATTGTCTGATCATCCTGATGACGCAGCTTCCTCCTCTTCAACTGATGTGG
CATCGAAAAGTCCACTCTCTTGGTTCGCAGACATTATCACTTCTTGCAGTGATGAGTTAGAAAGAAAGATTGATGGTTCT
GGAGAAGAGAATTCTTCTGGGGAGATTGACTACTTTGAAGCCATGACCCTGAGTTTACATCCGACCAAGGAAGAAGACTA
CATGCCAGAGCCATTAGTCCCTGAGAATATGATCTTCGAAGGGACGGGCTTGAACAAGCCAAGAAGAGGAAAAGCAAGAA
GAGGAAGACCGAAGAGGGATTTCCAGAGAGATACTCTCCCTGGACTCTCTTCTCTATCAAGGCACGAAGTCACTGAAGAT
ATACAGTTGTTTAGTGGGCTTATGAGAAGCAGAGAGTCCACCTCTGGTGGAGACAGTAGGGCTACAGGATGGGGAAAAGC
AACAAGAAGACCGAGGAGACAAAGGTGCCCTCCTCCTGCAACTGTAATCTTAACATGA