Details for Kale Locus Bo3g137080

Position : C3 ( 5`- 50032424 .. 50033463 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g137080

Protein [Map View]
RGRILANRKRARVKAPFLLRRHRSSLQQTNDLRSKKKKKQRDLSFKHFIMVLRSKYLCSFLLIIAILSHVSQSLHFELKS
GKSKCISEDIKSHAMTVGKYTVVNPNEPYPTPQSHKINIRVTSSHGNTYHHAEEVDSGQFSFTAVEGGEYSACFAAHDHK
PDVTLGIDLEWGTGVHYKSLGSLAKRSKVEVMEFEVKALIETVNSIHDEMFYLRDREEEMQDLNRATNSKMAWLGLLSLF
VCLGVAGMQFMHLKTFFEKKKVI*

DNA
CGTGGACGCATTCTCGCCAATCGGAAACGAGCACGTGTCAAAGCTCCCTTCCTCCTCCGTCGTCATCGTTCATCTCTGCA
ACAAACAAACGACCTGAGGAGCAAAAAAAAAAAAAAACAGAGAGATCTCTCCTTTAAACATTTCATCATGGTTCTCCGAT
CAAAATATCTATGCTCATTCCTCTTAATCATAGCCATCCTATCGCACGTTTCTCAATCTCTCCACTTCGAGTTAAAATCA
GGCAAATCAAAATGCATCTCGGAGGACATCAAAAGCCATGCGATGACCGTCGGAAAGTACACCGTCGTCAATCCCAACGA
GCCTTACCCTACTCCACAATCTCACAAGATCAACATAAGGGTGACGTCGAGTCACGGGAACACGTACCATCACGCGGAGG
AGGTGGACTCTGGGCAGTTCTCGTTCACGGCGGTGGAAGGTGGGGAATACTCGGCGTGTTTCGCTGCTCACGATCATAAG
CCTGACGTGACGTTGGGTATCGATTTGGAGTGGGGGACGGGTGTTCATTACAAGAGTTTGGGTAGTTTGGCGAAGAGGAG
CAAAGTCGAAGTCATGGAGTTTGAAGTAAAGGCATTGATTGAAACCGTTAACTCGATTCATGATGAGATGTTTTATCTTA
GAGACCGGGAGGAAGAGATGCAGGATCTGAACAGGGCTACAAACTCGAAGATGGCGTGGTTGGGTTTACTGTCTCTTTTC
GTGTGCTTAGGAGTTGCTGGGATGCAGTTTATGCACTTGAAGACGTTTTTTGAGAAGAAGAAAGTCATCTAA