Details for Kale Locus Bo3g070240

Position : C3 ( 5`- 27462624 .. 27463908 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g070240

Protein [Map View]
MASMSFALNRFGAKTTLSPDFEHSSSQSFRPSTRVGLKITSSSTATESEPDLSVTVNGLKMSNPFVIGSGPPVEAWRLAG
IQPPPAGFSQTSVFLNLHFLVAASKKQLSDHSNLKAFPWILWSLWKERNALVFERNRITPHSTIAKALEETEIWYQLLCN
DHPPHTTTASPNAPHGAWKKPPADVVKCNVGMAWEASDYISGSSWIVRDCQGKALHHSRQALLGSSSKMESDLRSLLWAV
QAMGDLRHKKVFFEASSVEVRESLLNPYRCPTLSSLILKILELLYCFEKWTIFHVTDQKNKVAKTIAESVISGSRVQSYV
ASGSPHWLHQMILEDARSV*

DNA
ATGGCATCCATGAGTTTCGCCTTAAATCGCTTCGGTGCTAAAACCACCTTATCACCCGACTTTGAACACTCCTCTAGCCA
GAGTTTTCGACCGTCGACTAGAGTCGGACTTAAGATCACCTCTTCTTCCACCGCCACCGAGTCAGAGCCTGATCTCAGTG
TCACAGTGAACGGTCTGAAAATGTCGAACCCTTTCGTGATCGGGTCGGGTCCACCAGTTGAAGCTTGGAGACTAGCAGGA
ATTCAACCTCCCCCAGCTGGTTTCTCCCAAACCTCTGTTTTTCTTAACCTTCATTTTTTGGTGGCAGCATCTAAAAAGCA
ACTGAGTGATCATAGCAATTTAAAAGCTTTTCCTTGGATTCTTTGGAGTCTTTGGAAAGAGAGGAATGCTCTAGTCTTTG
AAAGAAATCGCATCACACCTCATTCAACGATCGCTAAAGCTCTGGAGGAAACTGAGATATGGTACCAGCTTCTGTGTAAT
GACCATCCTCCACACACGACAACGGCCTCTCCCAACGCTCCCCATGGTGCGTGGAAAAAACCTCCGGCTGATGTTGTCAA
GTGTAATGTAGGTATGGCTTGGGAGGCATCTGATTATATAAGCGGCTCTAGTTGGATAGTAAGAGATTGCCAAGGAAAAG
CCCTACACCACAGTCGTCAGGCTCTCCTTGGTTCTTCTTCTAAAATGGAATCTGACCTTAGATCCCTACTTTGGGCTGTT
CAAGCAATGGGAGACTTGCGCCACAAGAAGGTTTTCTTTGAAGCTTCCTCGGTAGAAGTTCGTGAATCCTTACTAAACCC
CTACAGATGTCCTACTCTCTCATCTTTGATCCTGAAAATCCTGGAGCTCCTTTATTGCTTTGAGAAGTGGACTATATTTC
ATGTGACAGACCAAAAGAATAAGGTGGCCAAGACAATCGCAGAAAGTGTTATATCTGGTTCCCGGGTCCAATCATATGTC
GCTTCTGGAAGTCCTCATTGGCTCCATCAAATGATCCTAGAAGACGCAAGAAGTGTTTGA