Details for Kale Locus Bo3g070230

Position : C3 ( 5`- 27454753 .. 27456481 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g070230

Protein [Map View]
FSRESHISFYDINNRVRFAVLSKNQTKPKKVYFTSKIQIARRSRKFSLRNLHRRSSYLFSPTKISSFFCPRLDMDAATAS
LIQSPLLPHETSRNGAGSMFLTISGGFTPSGSKLQLRLKQNAFTRFSKPLQTSTTTASKTRRSFVVKASAASDDASSKPI
APLQLESPAGQFLSQILVSHPHLVPAAVEQQLEQLQTDRDSQGQNTDSSSSVPGTDIVLYRRIAELKENERHRTLEEILY
ALVVQKFMEANVSLIPSITPSSSDPSGRVDTWPNKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQISKLRVGQV
YAASVMYGYFLKRVDQRFQLEKTMKLLPGSGGADESKSSVEQPEDVTSIHPEVGSFAGGVSAKGFGSEIKPSRLRTYVMS
FDSETLQRYATIRSREAVGIVEKHTEALFGKPEIVITPQGTVDSSKEEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDA
RYQFVLN*

DNA
TTTTCCCGCGAGTCGCACATTTCATTTTATGATATAAATAATCGGGTCCGATTCGCAGTATTATCAAAGAACCAAACCAA
ACCAAAAAAAGTCTATTTTACAAGTAAAATTCAGATAGCTCGCCGTTCTCGAAAGTTCTCTCTCCGTAATCTGCATCGTC
GCTCTTCTTATCTCTTTTCTCCGACCAAAATCTCTTCTTTCTTCTGTCCGAGACTAGACATGGACGCCGCAACCGCGAGT
TTGATCCAATCTCCCCTCTTACCGCATGAAACTTCCCGCAACGGTGCTGGATCTATGTTCCTTACGATCAGTGGCGGGTT
CACACCTTCTGGTTCAAAACTTCAACTTCGACTAAAGCAAAACGCGTTCACTAGATTCTCAAAACCATTGCAAACGTCAA
CAACAACAGCTTCCAAAACTCGGAGAAGCTTTGTGGTTAAAGCTTCGGCAGCATCTGATGACGCTTCCTCCAAACCTATC
GCCCCGCTTCAGCTGGAGTCTCCCGCTGGTCAGTTCCTCTCTCAGATTCTGGTGAGCCATCCTCATCTCGTCCCTGCTGC
TGTTGAACAGCAGCTTGAGCAGCTCCAAACTGATCGTGACTCTCAGGGACAGAACACAGATTCATCATCGTCCGTCCCTG
GAACCGACATCGTTCTCTACAGGAGAATAGCTGAGTTGAAGGAGAACGAGAGACACAGGACGTTAGAAGAGATTCTATAC
GCATTGGTGGTTCAAAAGTTCATGGAAGCTAACGTATCACTCATACCATCAATAACCCCATCATCATCAGATCCCTCTGG
TCGTGTTGATACTTGGCCGAACAAAGTAGAGAAGCTTGAGCAGCTTCACTCTCCCGAGATGTACGAGATGATTCACAACC
ATCTAGCCTTAATCCTCGGGAGCAGAATTGGTGACTTGACTTCTGTCGCGCAGATAAGCAAACTCAGAGTTGGGCAAGTC
TACGCTGCTTCTGTCATGTATGGATACTTCTTGAAGCGTGTGGACCAAAGGTTTCAGCTTGAGAAGACGATGAAGCTTCT
TCCTGGTTCTGGTGGGGCTGATGAGAGTAAATCAAGCGTTGAGCAACCAGAGGATGTGACGTCGATTCACCCGGAGGTTG
GTTCATTTGCGGGTGGAGTTAGTGCTAAGGGCTTTGGGAGTGAGATTAAACCGTCCCGGTTAAGAACGTACGTGATGTCG
TTTGATAGTGAGACGCTTCAGAGATACGCTACCATTAGGTCAAGAGAAGCGGTTGGGATCGTAGAGAAGCACACTGAGGC
GTTGTTTGGTAAGCCTGAGATTGTGATCACACCGCAGGGGACGGTTGATTCATCCAAGGAGGAGCAGATAAAGATTAGCT
TTGGTGGAATGAAGAGGCTTGTCTTGGAGGCTGTGACTTTTGGGTCGTTTCTTTGGGATGTTGAAAGTCATGTTGATGCT
AGGTACCAGTTTGTATTGAACTAG