Details for Kale Locus Bo3g070140

Position : C3 ( 5`- 27392670 .. 27395852 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g070140

Protein [Map View]
SSPSFSTFHNSLDSLLHLCPSFLFFLASLFVFLFKLFCSPRFCLDMASPMENDDVPMLPASDTSSSSRTMPFTSRSRSTS
LANNSSTIDVFNSSTVVLGYTNHLGTQRRPPLVQMSDPLSSTRSPEPRFALPPPSTGASSDSVGASSSQPNERNHAYSRT
PRVFATSDFTLHNALDDDAKGWAKYFSGIIYPESNFVQIWTTFFALSCLCSIFVDPLFFYPIEIYKEERCIKIDWWTTNV
FVIVRSITDGLYALNIVLQFRLAYVDLESTVVGAGQLVDDPKKIASHYLRGKFLTDFFIVLPIPQILLLWIIPQLLGTSG
ANNTKNYLRAAILVQYIPKLRRLFPLLAGQTPRGFRFDSALAKFFINLLTFMLAGHVIGSCWYLLGLQRVNQCLRDACGN
SSFECKQLIDCGRENRTEVLHAWKINVSANACFQEDGFDYGIYLKAVNLTSNCTRWYRRYSYSLFWGFQQISTLAGNQVP
SYFFGEVLFTMCIIGLGLFLFALLIGNMQNFLQSLGRRDTEMTVRRRDVEQWMSHRRFPKDIRKRVREVERLNWNATRGV
NEELLFENMPDDLQRDIRRHLFAFLKKVRIFSEIDESILDAMRARLKQRTYLKNNKVLHRGGVVKKMVFILRGKMESIGE
DGYRILLSEGDVCGEELLTWCQERSSVNPDGTMIRMPSKGLLSSRDVWCVTNVEAFSLSVADLEDITSLFPNLEIPKEP*

DNA
TCATCTCCTTCCTTCTCAACTTTTCATAACTCTTTAGACTCTCTGCTTCACTTATGCCCTAGCTTCTTGTTTTTTCTTGC
TAGTCTCTTTGTTTTCCTCTTTAAACTTTTCTGTAGCCCAAGGTTTTGTCTCGATATGGCTTCTCCCATGGAGAACGATG
ATGTTCCCATGCTTCCAGCTTCAGACACATCATCATCATCTCGTACTATGCCTTTCACTTCCAGGTCACGTAGCACTTCC
CTTGCAAACAATTCTTCCACCATTGACGTATTCAACAGCTCGACAGTTGTTTTAGGCTACACAAATCATCTTGGAACCCA
GAGACGGCCTCCGTTAGTGCAAATGAGTGACCCTCTTTCCTCTACTCGCAGTCCTGAGCCTCGCTTTGCTCTTCCTCCTC
CTTCTACTGGTGCTTCTTCTGATTCCGTTGGTGCCTCCTCCTCTCAGCCTAATGAGAGGAATCATGCCTACAGCCGCACT
CCCAGAGTTTTTGCCACTTCTGATTTCACGCTCCATAACGCTCTTGATGATGATGCTAAAGGCTGGGCTAAATACTTTTC
TGGAATCATATATCCTGAGTCTAATTTCGTTCAGATCTGGACTACATTCTTTGCCTTATCATGCTTGTGTTCTATTTTCG
TAGATCCCCTCTTTTTCTACCCCATAGAAATATATAAGGAGGAGAGATGCATTAAGATCGACTGGTGGACGACTAATGTA
TTTGTAATTGTGAGAAGTATAACGGATGGCTTATACGCTTTGAACATCGTGCTTCAGTTCCGATTGGCATATGTAGATCT
TGAGTCTACGGTTGTTGGTGCTGGCCAGTTGGTTGATGATCCAAAAAAAATTGCTAGCCATTACTTACGAGGAAAATTTT
TGACAGACTTTTTCATAGTGTTGCCAATTCCACAGATATTGCTATTATGGATAATACCACAACTGTTAGGCACATCTGGG
GCAAACAATACAAAGAACTATTTACGTGCTGCAATTCTTGTCCAATACATTCCAAAATTACGTAGGCTTTTTCCTCTTCT
AGCCGGACAAACACCAAGAGGGTTCAGATTTGATTCGGCATTGGCCAAGTTTTTTATAAATCTTCTCACCTTCATGCTTG
CTGGTCATGTTATTGGCTCTTGCTGGTATCTTTTGGGTCTGCAGAGAGTTAATCAGTGCCTTCGAGATGCTTGCGGAAAT
TCTAGTTTTGAATGTAAACAACTAATAGATTGTGGTCGTGAAAACAGAACGGAAGTTTTACATGCATGGAAAATTAACGT
TAGTGCCAATGCTTGTTTTCAAGAGGATGGTTTTGATTATGGAATCTATTTGAAGGCAGTCAATCTCACTAGTAATTGTA
CTCGTTGGTACAGAAGATACAGTTACTCTCTTTTCTGGGGATTTCAGCAAATCAGCACGCTTGCTGGAAACCAAGTCCCA
AGTTACTTTTTTGGGGAGGTCTTATTTACTATGTGTATCATCGGACTGGGGCTTTTCCTTTTCGCGCTTCTTATCGGTAA
TATGCAAAACTTCCTTCAGTCTCTCGGCCGAAGGGATACAGAAATGACTGTAAGACGGCGAGATGTGGAGCAATGGATGA
GCCATAGACGGTTTCCAAAAGACATAAGAAAGAGAGTGCGAGAGGTTGAGAGGCTCAACTGGAATGCTACTAGAGGAGTT
AACGAAGAATTGCTCTTTGAGAATATGCCTGATGACCTTCAGAGAGATATAAGACGTCATCTCTTCGCATTTCTCAAGAA
GGTGAGGATATTTTCGGAGATTGATGAATCTATCTTAGATGCCATGCGTGCGAGGCTGAAACAGAGGACTTACTTAAAGA
ATAACAAGGTCTTGCACCGCGGAGGTGTAGTTAAGAAAATGGTATTCATATTGAGAGGTAAGATGGAGAGCATTGGAGAA
GACGGTTATCGAATTCTTTTATCAGAGGGAGACGTTTGTGGTGAAGAACTTCTCACTTGGTGCCAAGAACGCTCTTCTGT
AAACCCAGATGGGACTATGATAAGGATGCCATCAAAGGGACTGCTTAGCAGCAGAGATGTTTGGTGTGTGACAAACGTGG
AGGCGTTTTCACTCAGTGTAGCAGATCTTGAAGACATCACGAGCTTGTTCCCCAATCTCGAGATTCCTAAGGAGCCATAA