Details for Kale Locus Bo3g070130

Position : C3 ( 5`- 27381908 .. 27382348 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g070130

Protein [Map View]
MQDPAKVSDKIDELVSQLVIANLDKEILQHKLLHKEQQFHEVSQPIELLKKLVMLLEMEKEVAMEEKTNLGYKVTSLLEE
NRKLATEALLMKKEAVGVARVCDHFHNVCFLQGCIYSLQASRNSEPVYDKVSAECFGLDKHNTKNK*

DNA
ATGCAAGATCCTGCTAAGGTTTCAGACAAAATCGATGAGCTTGTATCACAACTTGTGATTGCAAACTTAGACAAAGAGAT
TCTGCAGCATAAGTTACTCCACAAGGAGCAGCAGTTTCATGAAGTCTCCCAGCCCATAGAGCTGTTGAAGAAGTTAGTCA
TGTTGCTGGAGATGGAGAAGGAAGTGGCTATGGAGGAGAAAACTAATCTTGGATACAAAGTAACTTCTCTCTTGGAGGAG
AACAGAAAGCTAGCTACAGAAGCGTTGTTAATGAAGAAAGAAGCTGTTGGGGTTGCTAGGGTGTGCGACCACTTCCACAA
TGTCTGCTTTCTCCAGGGCTGCATCTACTCGCTTCAGGCATCGAGAAACTCTGAGCCTGTATATGATAAGGTCTCAGCCG
AGTGCTTTGGCCTGGATAAGCATAATACCAAGAATAAGTAG