Details for Kale Locus Bo3g069000

Position : C3 ( 5`- 27321853 .. 27322629 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g069000

Protein [Map View]
MSLQRPNGNSSSSSSPKKRKTEESDEELSMVPDMEAAGSTGVLSSSADDGVNNPEIEQTQNATSTAKRRRGRNPEDKEYR
SLKRLLRNRVSAQQARERKKVYVSDLESRANELQNNNEQLEEKISTLMNENTMLRKMLINTRPKADDN*

DNA
ATGTCTCTTCAACGACCCAATGGGAACTCGAGCTCTTCTTCTTCCCCCAAGAAGCGCAAAACTGAGGAGAGTGATGAAGA
GTTGTCGATGGTTCCAGACATGGAAGCAGCTGGATCAACAGGTGTTCTAAGCAGCAGCGCCGACGACGGAGTCAACAATC
CGGAGATTGAACAGACCCAAAATGCAACCTCCACCGCTAAGCGCCGCCGTGGACGAAATCCAGAGGATAAAGAATACAGA
AGCCTTAAGAGATTGTTGAGAAACCGAGTATCTGCTCAACAAGCGAGGGAGAGGAAGAAAGTGTATGTGAGTGACTTGGA
ATCAAGAGCTAATGAGTTGCAGAACAATAATGAGCAGCTTGAGGAGAAGATTTCTACTTTGATGAACGAGAACACAATGC
TTCGCAAGATGCTTATTAACACAAGGCCTAAAGCTGATGACAATTAA