Details for Kale Locus Bo3g068990

Position : C3 ( 5`- 27317921 .. 27318664 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g068990

Protein [Map View]
MEICNSYSSSSVDSTKHSASESSVNLSLSLTFPSTSPQRATKQDWPPIKPRLRDTLKVRRRLLQRDYDTCLFVKVYMEGV
PIGRKLDLSTFSGYESLLESLSQMFNTSIICGNHRDRKHHVLTYQDTDGDWMMVGDIPWEMFLETVRRLKITKPEGC*

DNA
ATGGAGATTTGTAACTCTTATTCCTCATCCTCTGTCGACAGTACTAAGCATTCAGCTTCTGAATCTTCTGTTAATCTCTC
CCTTAGCCTCACATTTCCCTCTACTTCTCCACAAAGAGCGACAAAACAAGATTGGCCCCCGATAAAACCTCGTTTAAGAG
ATACACTAAAGGTTCGTCGTCGTCTTCTTCAACGCGATTACGACACATGTCTGTTTGTTAAGGTTTATATGGAAGGTGTT
CCCATTGGGAGAAAGCTCGATCTTTCCACATTCTCAGGCTACGAGAGTCTATTAGAAAGTCTGTCTCAAATGTTCAATAC
TTCAATTATCTGCGGTAATCATCGAGATAGAAAACACCATGTTTTGACATATCAAGACACAGATGGAGATTGGATGATGG
TCGGAGATATTCCATGGGAAATGTTTCTTGAAACCGTGAGAAGACTGAAGATCACGAAACCAGAGGGGTGTTAA