Details for Kale Locus Bo3g068980

Position : C3 ( 5`- 27309023 .. 27309268 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g068980

Protein [Map View]
MASWKKTIATPFKKAATLFNQPQQSPRKGCGGGKMDAKAREEHERRMVRELQGEVMACGYDDVLVMWSILDKSNSSNNLT
S*

DNA
ATGGCATCATGGAAGAAAACAATAGCAACACCATTCAAGAAGGCAGCAACACTCTTCAACCAACCGCAGCAATCGCCAAG
AAAGGGTTGCGGCGGTGGAAAAATGGATGCCAAAGCGAGGGAAGAGCACGAGAGGAGGATGGTAAGAGAGCTTCAAGGAG
AAGTTATGGCTTGTGGATACGATGATGTTCTCGTCATGTGGTCTATTCTCGACAAATCTAACTCCTCCAATAACCTCACT
TCTTAA