Details for Kale Locus Bo3g035300

Position : C3 ( 5`- 13657666 .. 13658704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035300

Protein [Map View]
MGLRMSESAKPYFAMVCLQFGYAGMNLVTKAVLDRGMSHYVLVSYRNAFATAAIAPFSFLSERKVRSKITFPIFMHIFVL
ALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEKVEMRKVRCQVKVVGTLVTLVGSILVILYKGPFIN
FSRSHLSTTTSLPLAGNYLKATAFLLVASLSWASFFILQIV*

DNA
ATGGGATTAAGGATGTCAGAATCAGCTAAACCTTACTTTGCAATGGTTTGCCTTCAGTTCGGATACGCCGGTATGAACCT
GGTCACTAAAGCCGTCCTTGACCGTGGTATGAGCCATTACGTTCTTGTTTCATATCGCAACGCTTTTGCCACTGCCGCGA
TTGCACCTTTTTCATTTCTCTCCGAAAGGAAAGTGAGGTCAAAGATAACGTTTCCAATATTCATGCACATATTTGTTCTT
GCTCTTCTTGGGCCTGTAATTGATCAAAATCTATATTACATCGGTCTGAAACTCACATCTCCGACGTTTTCATCGGCCGT
CAGCAACATCGTGCCGGCAATTACCTTTATCCTCGCCACTCTTTTCAGGATGGAGAAAGTGGAGATGAGAAAAGTAAGAT
GTCAAGTGAAAGTGGTGGGGACTTTAGTAACATTGGTTGGATCCATATTGGTGATATTATACAAAGGTCCTTTCATCAAT
TTCTCCCGATCTCACCTCAGTACCACCACCTCTTTGCCGCTGGCCGGTAATTATCTTAAAGCCACCGCCTTTCTCCTTGT
CGCCTCCCTCTCATGGGCTTCGTTCTTCATTCTTCAGATTGTTTGA