Details for Kale Locus Bo3g035220

Position : C3 ( 5`- 13637484 .. 13639073 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035220

Protein [Map View]
MNCLATTLIITCKTTLISDMAVAIDPFSDQFPYFNRSSQRCRLLSLTNLDFNFLGSSLAQSLNGMSQDDNIHRSVSSPCF
SIAASANMEEDKKATGAPRIEILGGQSVPTVRALVAEVTMAIVSGAQPLLLPSGLGGAYLLQTGKGHNIAVAKPVDEEPL
ALNNPKKSGSLMLGQPGMKHSIPVGETGIRELAAYLLDYQGFSNVPPTALVSISHVPFHVSDAFSFSSFPYKVASLQRFV
CHDFDAGELGPGSFTVTSVHRIGILDVRVLNLDRHAGNMLVKSCDQDERYNRLGIAELVPIDHGLCLPECLDDPYFEWLN
WPQALVPFTDTELQYISDLDPFKDAELLRNELQSLPESAIRVLIVCTVFLKQAAAAGLCLAEIGEKMTRDFSRGEDSFSL
LETLCTKAKATVVVDKGNEVNAELECEVEITEVFHVSKPPLAPKGPRANSIPASMLSSQNQRITVNAKEKKRGGTMKSRS
PPMRVNHAESEGVSFGDMTTVEWDMFLQSFQTLLQDALSKGPVPRLGKQ*

DNA
ATGAATTGCTTGGCTACGACCTTAATCATCACCTGCAAGACTACATTGATCTCTGATATGGCCGTGGCTATTGATCCATT
CAGTGACCAGTTCCCTTACTTCAACCGATCTTCACAAAGATGCAGACTCTTATCCCTAACCAACCTCGACTTCAACTTCC
TCGGATCTAGCCTGGCGCAATCCTTAAATGGAATGTCTCAAGATGACAACATCCATAGAAGCGTCTCCTCTCCTTGCTTC
TCCATAGCCGCCTCTGCTAATATGGAGGAAGACAAGAAAGCAACCGGTGCTCCACGGATTGAGATTCTTGGTGGACAGAG
TGTTCCCACTGTCCGTGCCCTTGTGGCTGAGGTGACCATGGCTATTGTATCTGGAGCTCAGCCTTTGCTTTTACCAAGTG
GCTTGGGAGGTGCTTATCTACTACAAACCGGTAAAGGTCATAACATAGCTGTGGCTAAACCGGTTGATGAGGAGCCTTTG
GCCTTAAACAATCCTAAAAAGTCTGGAAGTTTGATGCTCGGACAACCGGGAATGAAACATTCTATACCTGTCGGTGAAAC
TGGTATCAGAGAGTTAGCTGCTTACCTTCTTGATTACCAAGGCTTCTCTAATGTCCCACCAACAGCTCTGGTTAGCATCT
CGCATGTCCCGTTTCACGTCAGCGACGCCTTCTCCTTCTCCTCTTTTCCCTATAAGGTTGCTTCCTTGCAGCGGTTTGTG
TGTCATGATTTTGATGCGGGAGAGTTAGGTCCAGGAAGCTTTACGGTCACCTCGGTTCATAGGATTGGGATACTTGATGT
GAGAGTCTTGAACCTTGACAGGCACGCTGGGAACATGCTGGTGAAGAGTTGTGATCAAGACGAGCGTTATAACCGACTTG
GAATCGCTGAGCTTGTCCCTATAGATCATGGTCTTTGCCTCCCTGAGTGTCTAGATGATCCTTACTTTGAGTGGCTAAAC
TGGCCTCAAGCTTTGGTTCCATTCACCGACACTGAGCTGCAGTATATATCCGATCTGGACCCTTTCAAAGACGCGGAGCT
TCTGAGAAATGAACTACAGTCTTTGCCGGAATCTGCCATAAGGGTCCTCATTGTCTGCACGGTTTTCTTGAAACAAGCAG
CAGCTGCAGGGCTCTGTCTCGCAGAGATAGGTGAGAAGATGACAAGGGATTTCTCTAGAGGTGAAGATAGTTTCAGTCTG
TTGGAGACACTCTGCACCAAAGCGAAAGCAACTGTAGTAGTTGACAAAGGAAATGAAGTGAACGCGGAGCTCGAATGTGA
AGTGGAGATAACAGAGGTCTTTCATGTATCTAAACCACCTTTGGCTCCAAAAGGGCCACGTGCAAACTCTATCCCTGCTT
CAATGCTATCCTCACAGAACCAGCGGATTACTGTGAATGCAAAAGAAAAGAAGAGAGGAGGCACCATGAAGAGCAGGAGC
CCACCGATGCGTGTGAACCATGCTGAATCAGAAGGTGTGTCTTTCGGGGACATGACAACAGTCGAATGGGACATGTTCCT
GCAGAGCTTCCAGACACTTTTGCAAGATGCACTGAGCAAAGGGCCAGTGCCAAGATTAGGAAAACAATAA