Details for Kale Locus Bo3g035210

Position : C3 ( 5`- 13634855 .. 13635766 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035210

Protein [Map View]
MSSGGNTHWCHRCQRAVRLHGRDPVCSYCGGGFVELLELPQASPFGMFRSHRDVVERDPTFDLMDAFSDFMRNRETRARS
ISSGPENFPGLAPLLIFGGQVPYRLSGIESLFNGGSPGIGITRGNHTGDYFFGPGLEELFEQLSAGTTTRSGPPPAPRSS
IDALPTIKIAQRHLRSSDSNCAVCKDEFELGAEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRQELPSATSSQNRTTTRNN
RSSSNERRSPFSSFWPFRSSGSTSNSTHNRGSSASNSDGTDENHNYHQQQQSHMGYGGWPFDY*

DNA
ATGTCAAGCGGTGGAAACACCCACTGGTGCCATAGATGCCAGCGTGCTGTCCGGCTACACGGACGAGACCCTGTATGTTC
TTATTGTGGAGGTGGTTTTGTTGAACTGCTTGAACTCCCTCAAGCCAGCCCATTTGGTATGTTCAGATCTCACAGGGACG
TCGTGGAACGTGATCCTACTTTTGATCTCATGGATGCTTTCTCCGACTTTATGAGGAACCGAGAAACCAGAGCAAGATCC
ATCAGCTCTGGTCCTGAGAACTTTCCCGGTCTGGCTCCTCTCTTAATCTTTGGTGGTCAGGTTCCTTACAGACTATCTGG
AATCGAATCCCTCTTCAACGGCGGCTCGCCTGGCATCGGCATCACACGTGGTAACCACACTGGTGACTACTTCTTCGGTC
CTGGTCTTGAAGAGCTCTTTGAGCAGCTTTCAGCTGGGACTACTACTCGCAGCGGACCACCACCTGCTCCTAGATCTTCA
ATAGATGCATTGCCTACCATCAAGATCGCTCAGAGGCATCTTAGGTCTTCGGACTCCAACTGTGCTGTGTGCAAAGACGA
ATTTGAATTGGGAGCAGAAGCGAAACAGATGCCTTGTAACCATATCTATCATTCTGACTGCATTGTCCCGTGGCTGGTTC
AGCATAACTCATGCCCGGTCTGTCGCCAAGAGCTGCCGTCAGCTACAAGTAGTCAAAACAGAACCACCACCAGAAACAAC
AGAAGTAGTAGCAATGAAAGGAGGAGTCCTTTCTCTTCCTTCTGGCCATTTCGTTCGTCTGGTTCAACCTCAAACTCTAC
TCACAACCGCGGAAGCAGCGCAAGTAACTCGGATGGAACCGATGAGAACCATAACTACCATCAACAGCAACAGTCACATA
TGGGTTACGGTGGGTGGCCTTTTGATTACTAA