Details for Kale Locus Bo3g035140

Position : C3 ( 5`- 13579219 .. 13580789 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035140

Protein [Map View]
MDSDSNNTKSVKRNVVDQLVEGYESATQLQLLLSRQQSSHHIDQTRIVSGDPDPVNKLMGKILDSFHKTISVLDSFDQVA
NVSVVLEGSRNTSCGDDSTPVSCNGGDSGDSRKRLGVGKSKRGCYTRKKRSHTWTVEARRIDEDIYAWRKYGQKQILNSK
FPRSYFRCTHKPTQGCNATKQVQKHEQDPSLFQITYIGHHTCNVSDETQAKTEPLDLEIVLDSDNNKLAATISQDHVDPY
IQEQGNDISSLIGVGASMVKEEDYNNGDQNNDYCEGSSTYSDLSLVWPDVMMSDDRQHHQNHFYHGEASTTTSYQFSFID
NDQFSSLFDSYCSYEGTSAI*

DNA
ATGGACTCAGATAGTAACAATACCAAATCCGTTAAGAGAAACGTTGTGGACCAACTTGTTGAAGGCTACGAATCCGCTAC
TCAGCTTCAGCTTCTCCTCTCTCGTCAACAATCTAGTCACCACATCGATCAGACTCGTATTGTCTCTGGAGATCCGGATC
CAGTAAATAAGCTCATGGGTAAGATCTTGGATTCTTTCCACAAAACCATATCGGTTCTTGATTCTTTTGACCAAGTCGCC
AACGTCTCCGTCGTCCTTGAGGGTTCACGGAATACTTCATGCGGCGATGATTCAACTCCGGTGAGTTGCAACGGTGGAGA
TTCGGGCGATAGTAGAAAGAGACTTGGAGTTGGTAAAAGTAAAAGAGGATGCTACACTAGAAAAAAGAGATCACATACTT
GGACTGTGGAAGCTAGAAGAATTGATGAAGATATATATGCTTGGAGGAAATATGGACAAAAGCAGATTCTTAACTCCAAG
TTCCCAAGAAGTTACTTTAGATGCACACACAAGCCAACACAAGGATGCAATGCAACAAAGCAAGTTCAGAAACATGAGCA
AGACCCTTCTTTGTTTCAAATCACTTACATTGGCCACCATACATGTAATGTTAGTGACGAAACACAAGCAAAGACCGAGC
CTCTTGATCTCGAAATAGTATTGGATTCGGACAATAATAAATTGGCAGCAACCATTTCTCAGGACCATGTGGATCCATAT
ATACAAGAGCAAGGGAACGACATCAGTAGCCTGATCGGAGTAGGCGCAAGCATGGTGAAGGAGGAGGATTATAACAATGG
TGATCAGAATAATGACTATTGTGAGGGTTCTTCCACATATAGTGATTTGTCATTGGTTTGGCCAGACGTGATGATGTCTG
ATGATCGTCAACATCATCAGAATCACTTCTATCACGGTGAAGCTAGTACTACCACTTCTTATCAATTCTCTTTCATTGAC
AACGATCAATTCTCCTCCTTATTTGATTCCTACTGCTCTTACGAAGGAACAAGTGCTATATGA