Details for Kale Locus Bo3g035110

Position : C3 ( 5`- 13549043 .. 13550546 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035110

Protein [Map View]
MNSGSCSSLMEVGYDHHHHGHEELHVLAVDDNLIDRKLVEKLLKISSCKVTTAENAIRALEYLGLGDHNQHMALTNNNLK
VNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVIMSSEYIPTRISKCLASGAQMFMQKPLKLSDVEKLKCHLMNSRS*

DNA
ATGAACAGTGGCTCTTGTTCTTCTTTAATGGAAGTGGGTTATGATCACCATCATCATGGTCATGAAGAGCTTCATGTTTT
GGCCGTGGATGATAATCTTATTGACCGTAAACTCGTAGAGAAGTTGCTCAAGATCTCCTCTTGCAAAGTTACAACAGCAG
AGAATGCGATTAGAGCATTGGAGTATTTGGGTTTGGGAGATCATAATCAGCATATGGCATTGACCAATAATAATTTGAAG
GTGAATCTAATCATCACAGACTATTGCATGCCAGGAATGACAGGCTTCGAGCTACTCAAGAAAGTGAAGGAGTCATCGAA
TCTGAAAGAGGTCCCTGTTGTGATAATGTCTTCAGAGTACATTCCTACTCGCATCAGCAAATGTTTGGCTAGTGGAGCTC
AAATGTTTATGCAGAAGCCTCTGAAACTATCGGATGTTGAGAAACTTAAATGTCATCTCATGAACAGCAGAAGCTGA