Details for Kale Locus Bo3g035050

Position : C3 ( 5`- 13516510 .. 13517405 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035050

Protein [Map View]
MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYDGYTLPKLYAKTQYCVSCAIH
SHVVRVRSRTNRRVRTPPPRFVRRKEDAPKPGQPGQAPRPAGAAAAPRA*

DNA
ATGACATTCAAGCGCAGGAACGGAGGGAGGAACAAGCACAACCGCGGGCACGTGAAGCCAATCAGATGCTCCAACTGCGG
CAAATGCTGCCCAAAGGACAAGGCCATCAAGAGGTTCATCGTCAGGAACATTGTGGAGCAGGCTGCTATTAGAGATGTTC
AGGAAGCTAGCGTCTACGATGGGTACACGTTGCCTAAGCTGTATGCTAAGACGCAATACTGTGTCTCTTGTGCGATCCAC
TCTCACGTTGTTAGAGTCCGTTCACGCACCAACCGCAGGGTTCGTACCCCGCCGCCTCGTTTTGTTAGACGCAAGGAGGA
TGCTCCCAAGCCTGGACAACCTGGTCAGGCTCCTCGTCCTGCTGGAGCTGCAGCTGCCCCGCGTGCCTGA