Details for Kale Locus Bo3g035020

Position : C3 ( 5`- 13495655 .. 13497687 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo3g035020

Protein [Map View]
MSEEEHQSCVHDVMNIQTKSENFDPAGVSHAPGIRKVSSRAEIDTSPPFGSVQEAVTWFGGRGYWVPFKLQDNYNGVGEF
NIKRMEEHAAELEKDLIVKELETLDVLEALGSTKMIVEDLKRQLHQESLRSAENLSSDIKEMNNEHCNHNPISSPDLILM
ELKQAKINLSKTMDDLVMIQSSVESLNKKMKEEKEFLDKTREKLTYGFGGAVSLAEELSRVRVKPDETPREHVKMVAETG
LNQQNKNCLRTAEMRLVAARKMEEAARAAEALAIAEIAMLSSLQSNDESEFFFPEPPSSPLTPRGLRNVTDSSRSGVLKK
LEEATQGVKQSKQDLEAALNRVEIANVKQLAAENAFRGWTKHTPTSQTRRSFFRHLNRQHEPVLKSNVSMRDVLRRKQVP
KEEVVVSERQSLEGQRRNVNLSQMLRELKHDIKSSVRGEKEEVREDKQFVTQRRKFGFIHITLPMQKQSKKKTSV*

DNA
ATGTCAGAGGAGGAGCATCAGAGTTGTGTCCATGATGTCATGAATATTCAAACCAAGTCCGAGAATTTCGACCCGGCTGG
TGTTTCTCATGCACCCGGGATAAGGAAAGTGAGTTCCAGAGCTGAGATTGATACTTCTCCTCCATTCGGCTCGGTTCAGG
AGGCAGTGACTTGGTTCGGTGGTCGTGGCTATTGGGTTCCTTTCAAGCTTCAAGACAATTACAATGGTGTGGGAGAATTT
AATATAAAGAGGATGGAAGAGCATGCAGCAGAGCTAGAGAAGGATCTGATAGTGAAAGAGCTAGAAACTCTAGATGTTCT
AGAAGCACTTGGATCAACTAAGATGATTGTTGAAGACTTGAAGCGGCAGCTTCATCAAGAATCCTTGAGATCAGCTGAGA
ATCTCAGTTCAGACATCAAAGAGATGAACAATGAGCATTGCAATCACAACCCCATATCATCTCCCGATCTGATCTTAATG
GAACTGAAGCAAGCCAAGATAAATCTTAGTAAAACCATGGATGATCTTGTGATGATCCAGTCCTCTGTTGAGTCTCTGAA
CAAGAAAATGAAGGAAGAGAAAGAGTTTCTTGACAAGACAAGAGAGAAGCTCACGTATGGGTTTGGAGGAGCGGTGTCTC
TAGCTGAGGAGCTGAGTAGAGTTAGGGTGAAACCAGATGAAACACCAAGAGAACATGTGAAGATGGTCGCTGAAACGGGT
CTTAACCAACAGAACAAGAACTGTCTGAGAACTGCGGAGATGAGACTGGTTGCTGCTAGAAAAATGGAAGAAGCTGCAAG
AGCTGCGGAAGCACTAGCCATTGCTGAGATAGCAATGTTATCATCATTACAATCAAACGATGAAAGCGAGTTTTTCTTTC
CAGAGCCTCCAAGTTCTCCCTTAACACCAAGAGGACTAAGGAATGTTACTGATAGCTCAAGAAGTGGGGTCTTGAAGAAG
CTTGAGGAAGCTACACAAGGAGTTAAACAAAGTAAACAAGATCTAGAAGCTGCGTTAAACCGTGTAGAGATTGCTAACGT
GAAGCAACTCGCAGCTGAAAACGCTTTCCGCGGGTGGACAAAACACACACCTACGAGTCAAACCCGACGCTCTTTTTTCA
GACATCTGAATAGGCAGCATGAGCCAGTTCTAAAGTCTAATGTCTCGATGCGTGATGTTCTGAGGCGTAAGCAAGTTCCG
AAGGAAGAGGTTGTTGTCTCCGAGAGGCAGAGTCTTGAAGGACAAAGGCGGAATGTGAATTTGAGTCAAATGCTGAGGGA
GCTGAAGCATGATATTAAGTCTTCGGTACGAGGTGAGAAAGAGGAGGTACGTGAAGATAAACAGTTTGTCACGCAGAGGA
GAAAGTTTGGGTTCATACACATTACGCTTCCCATGCAGAAACAGAGTAAGAAGAAAACTAGCGTTTAA