Details for Kale Locus Bo2g136840

Position : C2 ( 5`- 43696187 .. 43697303 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g136840

Protein [Map View]
MDLLRRSLVCLLIVALFSPTALSMQFELRSGQMKCISEDIHEKSISVGKYFIVNPNEDHPLPDSHKITAKMVSPKWNALH
EAVKVEAGEFSFTAFETGDYFTCISAVDHKPQTTLTIDFVWTSGVHSAASKDWSKVPKRSQVKMMELSVKRLFDTVESIH
DEMYYLRDREAEMQELNRSTNSKMAWFSFLSLGFSLSVAGLQFWHLKSFFEKKKLI*

DNA
ATGGATCTTCTTCGTAGGAGCTTGGTTTGTCTTTTGATCGTTGCGTTATTTTCTCCTACAGCACTATCAATGCAGTTCGA
GCTTCGTTCTGGCCAGATGAAATGCATATCGGAGGATATTCACGAAAAGTCCATCAGCGTTGGCAAATACTTCATTGTAA
ACCCTAACGAAGATCATCCTCTTCCTGATTCTCACAAAATCACCGCCAAGATGGTGTCGCCAAAATGGAATGCGCTGCAC
GAAGCTGTTAAGGTAGAGGCTGGAGAGTTCTCGTTTACTGCGTTTGAAACCGGTGATTACTTTACGTGCATCTCAGCCGT
TGATCATAAGCCGCAGACGACGTTGACCATTGATTTTGTTTGGACGTCTGGTGTTCACTCTGCTGCCTCCAAGGATTGGT
CTAAAGTGCCAAAGAGGAGCCAAGTCAAAATGATGGAGTTGTCGGTTAAGAGGCTATTCGACACTGTTGAGTCCATCCAC
GATGAGATGTATTATCTTCGTGATAGGGAAGCAGAAATGCAAGAGTTGAATAGATCCACAAATTCGAAAATGGCGTGGTT
TAGTTTCTTGTCACTTGGGTTTAGTTTATCGGTAGCTGGTTTACAGTTTTGGCACTTGAAATCTTTCTTCGAGAAAAAGA
AACTCATCTAA