Details for Kale Locus Bo2g082550

Position : C2 ( 5`- 23165728 .. 23168559 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082550

Protein [Map View]
MSFRDETEDARNDLRRPFIHTGSWYRMGSRQSSMMGSSQIIKDNSISVLACVLIVALGPIQFGFTCGYSSPTQAEITKDL
GLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMIAAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVP
VYIAEIAPQNMRGGLGSVNQLSVTIGIMLAYLLGLFVPWRILAVLGTLPCIVLIPGLFFIPESPRWLAKMGMTDDFETSL
QVLRGFETDITVEVNEIKRSVASSTKRSSTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGINGVLFYSSTIFESAGVTSSN
AATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISLVIVAAAFYLKGFVSPDSDMYSMLSILSVVGVVAMVVSFS
LGMGPIPWLIMSEILPVNIKGLAGSIATLANWFFSWLITMTANLLLAWSSGATFTIYGVVCAFTVVFVTLWVPETKGKTL
EELQALFR*

DNA
ATGAGTTTCAGGGATGAAACAGAGGATGCGAGGAATGATCTGCGACGACCATTCATCCACACGGGAAGCTGGTACCGGAT
GGGTTCGAGACAATCTAGTATGATGGGTTCGTCTCAGATTATTAAAGACAACTCAATCTCTGTTCTTGCTTGTGTCTTGA
TCGTTGCTCTTGGTCCTATTCAATTCGGATTCACTTGTGGTTATTCTTCTCCAACTCAAGCTGAAATCACCAAGGATCTT
GGTTTAACTGTATCTGAGTACTCTGTGTTTGGTTCTCTGTCCAATGTGGGTGCTATGGTTGGTGCAATTGCTAGTGGTCA
GATTGCAGAATACATTGGAAGAAAAGGGTCTCTGATGATTGCTGCGATTCCCAATATCATTGGATGGCTTTGCATATCAT
TTGCGAAAGATACTTCTTTTCTTTACATGGGGCGTCTTTTAGAAGGCTTTGGTGTTGGTATCATCTCTTACACGGTGCCT
GTATATATAGCTGAGATAGCTCCACAAAACATGAGAGGAGGATTGGGTTCAGTTAACCAGCTTTCCGTAACAATTGGAAT
AATGCTGGCTTACTTACTTGGCCTCTTTGTTCCATGGAGAATTCTAGCAGTTCTTGGTACATTGCCTTGCATAGTACTCA
TACCAGGCCTCTTTTTCATCCCTGAATCTCCTCGCTGGCTGGCAAAGATGGGTATGACTGATGATTTTGAGACTTCATTA
CAAGTTCTTAGAGGATTTGAGACGGATATCACCGTTGAGGTTAATGAAATCAAGAGATCTGTGGCATCATCTACAAAGCG
ATCATCTACAGTTCGGTTTGTAGATCTCAAGCGCAGGAGATACTACTTCCCTCTTATGGTTGGTATAGGGTTGCTTGTAC
TTCAACAACTCGGTGGAATCAATGGCGTCCTGTTTTATTCCAGTACAATCTTTGAATCTGCAGGAGTTACCTCGAGTAAC
GCAGCAACATTTGGGGTCGGTGCTATTCAGGTAGTGGCCACTGCAATATCAACATGGTTGGTGGACAAAGCAGGTCGTAG
GCTTCTGCTTACTATCTCTTCGGTTGGGATGACGATTAGCCTTGTGATTGTTGCAGCTGCTTTCTACCTTAAGGGATTTG
TGTCTCCTGATTCAGACATGTACAGTATGCTGAGCATCTTGTCAGTAGTAGGAGTAGTGGCAATGGTTGTTTCTTTCTCA
TTGGGAATGGGACCAATCCCATGGCTCATTATGTCTGAGATCCTTCCTGTGAACATAAAGGGTTTAGCTGGCAGTATAGC
AACTTTAGCTAATTGGTTCTTCTCTTGGTTGATCACCATGACTGCTAACTTGCTCTTAGCCTGGAGCAGTGGAGCAACTT
TCACTATATACGGGGTGGTTTGTGCATTCACAGTGGTGTTTGTGACTCTGTGGGTTCCTGAGACCAAAGGGAAAACGCTT
GAAGAACTTCAAGCCTTATTCAGATGA