Details for Kale Locus Bo2g082500

Position : C2 ( 5`- 23148471 .. 23150778 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082500

Protein [Map View]
MKMRKLCPNLDNEDGLETVLEVPVPEEMFTKMGSNATGRWRNMHALMKAHAVVTAVAADMRTPASSSSMSNVNMHLQSKS
DNEFVALLKIVGSPLIPFHVPLEFCLSRPINDTSIEASTAKYIVQQYVAACGGPAALNAVKSMYAVGQVRMQGSEMVAGE
DEGTTTTPVRLGKGNFEVGGFVLWQKNPNLWFLELVVSGFKISAGSDGKVAWNQSSTQPSQAHRGPPRPLRRFFQGLDPR
CTASLFLDAVCIGEQTVNNEDCFVLKVETPADILKAQCSPNTEVIHHTVWGYFSQRTGLLVKFGDTKLVRVKSARGKSDG
VFWETSMESIIDDYKYVDSVNIAHGGRTLTTLYRYGGAVNHRRRIEEKWTIEEVDFNICGLCLESFLPPSDMNNDH*

DNA
ATGAAGATGAGGAAGCTTTGTCCGAATCTAGACAATGAAGACGGGTTAGAGACGGTGTTAGAGGTCCCTGTACCGGAAGA
AATGTTTACGAAGATGGGAAGCAACGCGACGGGACGGTGGAGGAATATGCACGCTCTTATGAAGGCGCATGCCGTCGTGA
CAGCAGTCGCGGCTGACATGAGAACGCCAGCGTCTTCTTCGTCGATGAGTAATGTTAATATGCATTTGCAGTCAAAATCA
GACAACGAGTTTGTGGCGTTGTTGAAGATCGTGGGAAGTCCTCTTATTCCTTTTCATGTTCCTCTCGAGTTCTGTCTCTC
CCGACCCATCAATGACACTTCCATCGAGGCGTCAACAGCTAAGTATATAGTGCAGCAGTACGTGGCTGCGTGTGGAGGTC
CAGCCGCTTTGAATGCAGTGAAGAGCATGTACGCAGTGGGGCAGGTGAGGATGCAAGGCTCAGAGATGGTTGCTGGAGAG
GATGAAGGGACCACTACTACGCCGGTGCGGCTGGGGAAAGGCAATTTTGAAGTCGGAGGTTTTGTTTTATGGCAGAAGAA
TCCAAACCTTTGGTTCTTGGAGCTGGTGGTTTCCGGTTTCAAGATTAGCGCCGGTAGTGACGGCAAAGTGGCTTGGAACC
AATCATCTACCCAACCTTCCCAGGCTCACCGTGGCCCTCCCCGCCCTCTCCGACGTTTTTTTCAGGGACTTGACCCGAGG
TGCACGGCTAGTCTATTTCTAGACGCCGTTTGCATCGGCGAACAAACCGTAAACAACGAAGACTGTTTCGTCTTAAAGGT
AGAGACACCGGCAGATATTCTCAAGGCGCAGTGTTCGCCTAATACGGAGGTGATCCACCACACGGTGTGGGGTTACTTCA
GCCAACGGACGGGACTTCTCGTGAAATTCGGTGACACAAAGCTCGTGAGAGTCAAATCCGCTAGGGGCAAGAGCGACGGT
GTATTTTGGGAGACAAGCATGGAGTCAATCATTGACGACTACAAGTACGTTGACTCGGTTAACATAGCACACGGTGGTCG
AACGTTGACCACGCTTTATCGTTATGGAGGAGCTGTTAACCACCGGAGACGAATAGAGGAGAAATGGACGATTGAGGAAG
TGGATTTTAATATTTGTGGTTTGTGTTTGGAGAGCTTCTTGCCACCGTCGGATATGAACAATGATCATTAG