Details for Kale Locus Bo2g082470

Position : C2 ( 5`- 23130484 .. 23132269 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082470

Protein [Map View]
MLEAADNSNVLNRGFSQLQNCFGDCSSEEELTVLPRHTKVVVTGNNRTKSVLVGLQGVVQKAVGLGGWHWLVLTNGIEVK
LQRNALSVIEAPTGNEEGDDVEVEHTQWNPSDMTYEDTLKPHKSKQRGYRSARLSHKAMCRALSSDSHSKSSTITPPVNM
KVDLSKLDMPALQRYIRHFNLVDALPNPSKEQLLDIVQRHFMSQEMDELQVIMGFVQAAKGMKKTCRWNLREHQKH*

DNA
ATGCTGGAAGCTGCTGATAACTCAAACGTCCTCAACAGAGGATTCTCTCAGCTTCAGAATTGCTTCGGTGATTGCAGTAG
CGAAGAAGAACTAACCGTCCTGCCACGTCATACCAAAGTGGTGGTCACCGGAAACAACCGTACCAAATCTGTCCTCGTCG
GTCTTCAAGGCGTCGTTCAGAAAGCCGTCGGGCTCGGTGGTTGGCATTGGCTGGTTTTGACAAATGGAATCGAAGTGAAG
TTGCAGAGGAATGCGCTTAGTGTCATTGAAGCTCCTACAGGGAACGAAGAAGGCGATGATGTCGAAGTTGAGCATACACA
ATGGAATCCCTCTGATATGACATATGAAGACACTTTGAAGCCTCACAAGTCGAAGCAAAGAGGATACAGATCAGCGCGGT
TATCACATAAGGCAATGTGCAGGGCCTTATCTTCTGACTCACACTCAAAAAGCTCGACTATTACTCCTCCTGTGAACATG
AAGGTTGATCTTAGCAAATTGGATATGCCTGCATTACAGAGATACATACGACATTTTAACCTCGTGGATGCACTTCCTAA
CCCGTCAAAAGAGCAGCTACTTGACATTGTTCAGCGACACTTCATGTCTCAGGAGATGGATGAGCTTCAGGTTATAATGG
GATTCGTTCAAGCTGCAAAAGGAATGAAGAAAACTTGCAGGTGGAATTTAAGAGAACACCAGAAACACTGA