Details for Kale Locus Bo2g082450

Position : C2 ( 5`- 23122707 .. 23124889 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo2g082450

Protein [Map View]
RRLSGGRRKSVSFEDLSSRRLFRPCRILPIRLVDLRYTLPSLIISLIRFGSFYETLVLRFTFIHSFLCSIITFYPSSFLP
SSPTWLHPPSPSNFSRFYLEKMEVTGDSDNLKNRSLTPVRTLRGLIILLIFLSTAFMFLIYFAPPFALALRLLSVHQSRK
SISFIFGHWLALWPYLFETINGTTVIFSGDTLPVEKRVLLIANHRTEVDWMYLWNIALRKGCLGYIKYVLKSSLMRLPIF
GWGFHVLEFIPVERKREVDEPVMLQMLSSFKDPREPLWLALFPEGTDFTEEKCKRSQKFAAEAGLPTLSNVLLPKTRGFS
VCLDALHNSLDAVYDLTIAYKPRCPSFMDNVFGTDPSEVHIHVKRVLTKEIPASEAESSAWLMDSFKSKDRLLSDFNAQG
QFPNQRPEEELSILKCIATFGVIVSLTVLFLYLTLYSHSCFKVYVGLSFTYLSFATYYKFRPSPSVGCCKGGSSCKEAKT
H*

DNA
AGAAGATTATCGGGTGGTCGTCGCAAAAGTGTCAGCTTCGAGGATTTGTCTTCGCGGCGGCTTTTTAGACCTTGTCGTAT
ACTGCCAATTAGATTGGTTGATTTACGGTACACCCTACCGTCTCTGATCATATCTCTAATCAGATTTGGATCCTTCTACG
AAACTTTGGTTCTGAGATTCACATTCATTCATTCATTCCTCTGTTCCATTATAACGTTTTATCCTTCTTCCTTCCTTCCC
TCTTCACCAACTTGGCTTCACCCTCCCTCCCCCTCTAACTTCTCCAGGTTTTATCTGGAAAAGATGGAAGTTACCGGAGA
CTCTGATAACTTAAAGAACCGCTCCTTGACTCCTGTTAGGACTCTGAGGGGTCTCATCATCTTACTCATCTTCCTCTCTA
CTGCTTTCATGTTCCTCATCTACTTCGCACCACCTTTTGCTCTAGCTCTACGCCTTCTCAGCGTCCACCAATCTAGAAAA
TCTATATCCTTCATCTTTGGTCACTGGCTAGCTCTATGGCCTTACCTCTTCGAAACGATCAACGGAACAACAGTAATTTT
CTCCGGAGACACCCTTCCCGTAGAGAAACGTGTTTTGCTAATAGCAAACCACAGGACAGAGGTGGACTGGATGTATCTTT
GGAACATCGCATTGAGGAAAGGCTGTCTTGGCTACATCAAGTACGTCCTCAAGAGCAGCTTGATGAGGCTGCCTATCTTC
GGATGGGGGTTTCATGTTCTTGAGTTTATACCAGTTGAGAGGAAGCGTGAGGTCGACGAGCCTGTTATGCTTCAAATGCT
TTCATCGTTTAAAGACCCTCGTGAGCCCTTGTGGCTAGCTCTCTTCCCTGAAGGAACTGACTTCACTGAAGAGAAATGCA
AGAGAAGCCAAAAGTTTGCAGCCGAAGCTGGTCTTCCAACACTATCAAACGTACTTTTACCGAAGACAAGAGGCTTCAGC
GTTTGCTTAGATGCTCTACATAACTCTTTGGATGCAGTTTATGATTTGACTATAGCGTATAAGCCTCGCTGCCCATCTTT
CATGGACAATGTATTCGGAACTGATCCTTCAGAAGTTCACATCCACGTTAAGCGAGTTCTAACAAAGGAGATTCCAGCAA
GCGAGGCAGAGTCTTCTGCTTGGTTAATGGATTCGTTTAAGTCCAAGGACAGGCTGCTATCTGATTTCAATGCTCAAGGG
CAGTTCCCAAATCAAAGACCAGAAGAAGAACTATCTATTCTCAAGTGCATTGCAACATTTGGAGTGATAGTATCTTTGAC
GGTACTGTTTCTTTATCTGACCTTGTATTCACATAGCTGTTTCAAAGTATATGTTGGTCTAAGCTTCACATATTTGTCTT
TTGCTACTTATTATAAGTTCCGGCCCTCACCATCTGTTGGTTGTTGTAAAGGAGGTTCTTCTTGTAAAGAAGCAAAAACC
CATTAA